Cargando…

Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex

Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior tha...

Descripción completa

Detalles Bibliográficos
Autores principales: Sermet, B Semihcan, Truschow, Pavel, Feyerabend, Michael, Mayrhofer, Johannes M, Oram, Tess B, Yizhar, Ofer, Staiger, Jochen F, Petersen, Carl CH
Formato: Online Artículo Texto
Lenguaje:English
Publicado: eLife Sciences Publications, Ltd 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6924959/
https://www.ncbi.nlm.nih.gov/pubmed/31860443
http://dx.doi.org/10.7554/eLife.52665
_version_ 1783481825869430784
author Sermet, B Semihcan
Truschow, Pavel
Feyerabend, Michael
Mayrhofer, Johannes M
Oram, Tess B
Yizhar, Ofer
Staiger, Jochen F
Petersen, Carl CH
author_facet Sermet, B Semihcan
Truschow, Pavel
Feyerabend, Michael
Mayrhofer, Johannes M
Oram, Tess B
Yizhar, Ofer
Staiger, Jochen F
Petersen, Carl CH
author_sort Sermet, B Semihcan
collection PubMed
description Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs.
format Online
Article
Text
id pubmed-6924959
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher eLife Sciences Publications, Ltd
record_format MEDLINE/PubMed
spelling pubmed-69249592019-12-23 Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex Sermet, B Semihcan Truschow, Pavel Feyerabend, Michael Mayrhofer, Johannes M Oram, Tess B Yizhar, Ofer Staiger, Jochen F Petersen, Carl CH eLife Neuroscience Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs. eLife Sciences Publications, Ltd 2019-12-20 /pmc/articles/PMC6924959/ /pubmed/31860443 http://dx.doi.org/10.7554/eLife.52665 Text en © 2019, Sermet et al http://creativecommons.org/licenses/by/4.0/ http://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use and redistribution provided that the original author and source are credited.
spellingShingle Neuroscience
Sermet, B Semihcan
Truschow, Pavel
Feyerabend, Michael
Mayrhofer, Johannes M
Oram, Tess B
Yizhar, Ofer
Staiger, Jochen F
Petersen, Carl CH
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title_full Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title_fullStr Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title_full_unstemmed Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title_short Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
title_sort pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
topic Neuroscience
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6924959/
https://www.ncbi.nlm.nih.gov/pubmed/31860443
http://dx.doi.org/10.7554/eLife.52665
work_keys_str_mv AT sermetbsemihcan pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT truschowpavel pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT feyerabendmichael pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT mayrhoferjohannesm pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT oramtessb pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT yizharofer pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT staigerjochenf pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex
AT petersencarlch pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex