Cargando…
Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex
Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior tha...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
eLife Sciences Publications, Ltd
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6924959/ https://www.ncbi.nlm.nih.gov/pubmed/31860443 http://dx.doi.org/10.7554/eLife.52665 |
_version_ | 1783481825869430784 |
---|---|
author | Sermet, B Semihcan Truschow, Pavel Feyerabend, Michael Mayrhofer, Johannes M Oram, Tess B Yizhar, Ofer Staiger, Jochen F Petersen, Carl CH |
author_facet | Sermet, B Semihcan Truschow, Pavel Feyerabend, Michael Mayrhofer, Johannes M Oram, Tess B Yizhar, Ofer Staiger, Jochen F Petersen, Carl CH |
author_sort | Sermet, B Semihcan |
collection | PubMed |
description | Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs. |
format | Online Article Text |
id | pubmed-6924959 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | eLife Sciences Publications, Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-69249592019-12-23 Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex Sermet, B Semihcan Truschow, Pavel Feyerabend, Michael Mayrhofer, Johannes M Oram, Tess B Yizhar, Ofer Staiger, Jochen F Petersen, Carl CH eLife Neuroscience Mouse primary somatosensory barrel cortex (wS1) processes whisker sensory information, receiving input from two distinct thalamic nuclei. The first-order ventral posterior medial (VPM) somatosensory thalamic nucleus most densely innervates layer 4 (L4) barrels, whereas the higher-order posterior thalamic nucleus (medial part, POm) most densely innervates L1 and L5A. We optogenetically stimulated VPM or POm axons, and recorded evoked excitatory postsynaptic potentials (EPSPs) in different cell-types across cortical layers in wS1. We found that excitatory neurons and parvalbumin-expressing inhibitory neurons received the largest EPSPs, dominated by VPM input to L4 and POm input to L5A. In contrast, somatostatin-expressing inhibitory neurons received very little input from either pathway in any layer. Vasoactive intestinal peptide-expressing inhibitory neurons received an intermediate level of excitatory input with less apparent layer-specificity. Our data help understand how wS1 neocortical microcircuits might process and integrate sensory and higher-order inputs. eLife Sciences Publications, Ltd 2019-12-20 /pmc/articles/PMC6924959/ /pubmed/31860443 http://dx.doi.org/10.7554/eLife.52665 Text en © 2019, Sermet et al http://creativecommons.org/licenses/by/4.0/ http://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use and redistribution provided that the original author and source are credited. |
spellingShingle | Neuroscience Sermet, B Semihcan Truschow, Pavel Feyerabend, Michael Mayrhofer, Johannes M Oram, Tess B Yizhar, Ofer Staiger, Jochen F Petersen, Carl CH Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title | Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_full | Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_fullStr | Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_full_unstemmed | Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_short | Pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
title_sort | pathway-, layer- and cell-type-specific thalamic input to mouse barrel cortex |
topic | Neuroscience |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6924959/ https://www.ncbi.nlm.nih.gov/pubmed/31860443 http://dx.doi.org/10.7554/eLife.52665 |
work_keys_str_mv | AT sermetbsemihcan pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT truschowpavel pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT feyerabendmichael pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT mayrhoferjohannesm pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT oramtessb pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT yizharofer pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT staigerjochenf pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex AT petersencarlch pathwaylayerandcelltypespecificthalamicinputtomousebarrelcortex |