Cargando…

Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level

BACKGROUND: Rural communities in Nigeria account for high maternal and newborn mortality rates in the country. Thus, there is a need for innovative models of service delivery, possibly with greater community engagement. Introducing and strengthening community midwifery practice within the Nigerian p...

Descripción completa

Detalles Bibliográficos
Autores principales: Okereke, Ekechi, Ishaku, Salisu Mohammed, Unumeri, Godwin, Mohammed, Bello, Ahonsi, Babatunde
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6929448/
https://www.ncbi.nlm.nih.gov/pubmed/31870383
http://dx.doi.org/10.1186/s12960-019-0430-0
_version_ 1783482702722236416
author Okereke, Ekechi
Ishaku, Salisu Mohammed
Unumeri, Godwin
Mohammed, Bello
Ahonsi, Babatunde
author_facet Okereke, Ekechi
Ishaku, Salisu Mohammed
Unumeri, Godwin
Mohammed, Bello
Ahonsi, Babatunde
author_sort Okereke, Ekechi
collection PubMed
description BACKGROUND: Rural communities in Nigeria account for high maternal and newborn mortality rates in the country. Thus, there is a need for innovative models of service delivery, possibly with greater community engagement. Introducing and strengthening community midwifery practice within the Nigerian primary healthcare system is a clear policy option. The potential of community midwifery to increase the availability of skilled care during pregnancy, at birth and within postpartum periods in the health systems of developing countries has not been fully explored. This study was designed to assess stakeholders’ perceptions about the performance of community health workers and the feasibility of introducing and using community midwifery to address the high maternal and newborn mortality within the Nigerian healthcare system. METHODS: This study was undertaken in two human resources for health (HRH) project focal states (Bauchi and Cross River States) in Nigeria, utilizing a qualitative research design. Interviews were conducted with 44 purposively selected key informants. Key informants were selected based on their knowledge and experience working with different cadres of frontline health workers at primary healthcare level. The qualitative data were audio-recorded, transcribed and then thematically analysed. RESULTS: Some study participants felt that introducing community midwifery will increase access to maternal and newborn healthcare services, especially in rural communities. Others felt that applying community midwifery at the primary healthcare level may lead to duplication of duties among the health worker cadres, possibly creating disharmony. Some key informants suggested that there should be concerted efforts to train and retrain the existing cadres of community health workers via the effective implementation of the task shifting policy in Nigeria, in addition to possibly revising the existing training curricula, instead of introducing community midwifery. CONCLUSION: Applying community midwifery within the Nigerian healthcare system has the potential to increase the availability of skilled care during pregnancy, at birth and within postpartum periods, especially in rural communities. However, there needs to be broader stakeholder engagement, more awareness creation and the careful consideration of modalities for introducing and strengthening community midwifery training and practice within the Nigerian health system as well as within the health systems of other developing countries.
format Online
Article
Text
id pubmed-6929448
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-69294482019-12-30 Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level Okereke, Ekechi Ishaku, Salisu Mohammed Unumeri, Godwin Mohammed, Bello Ahonsi, Babatunde Hum Resour Health Research BACKGROUND: Rural communities in Nigeria account for high maternal and newborn mortality rates in the country. Thus, there is a need for innovative models of service delivery, possibly with greater community engagement. Introducing and strengthening community midwifery practice within the Nigerian primary healthcare system is a clear policy option. The potential of community midwifery to increase the availability of skilled care during pregnancy, at birth and within postpartum periods in the health systems of developing countries has not been fully explored. This study was designed to assess stakeholders’ perceptions about the performance of community health workers and the feasibility of introducing and using community midwifery to address the high maternal and newborn mortality within the Nigerian healthcare system. METHODS: This study was undertaken in two human resources for health (HRH) project focal states (Bauchi and Cross River States) in Nigeria, utilizing a qualitative research design. Interviews were conducted with 44 purposively selected key informants. Key informants were selected based on their knowledge and experience working with different cadres of frontline health workers at primary healthcare level. The qualitative data were audio-recorded, transcribed and then thematically analysed. RESULTS: Some study participants felt that introducing community midwifery will increase access to maternal and newborn healthcare services, especially in rural communities. Others felt that applying community midwifery at the primary healthcare level may lead to duplication of duties among the health worker cadres, possibly creating disharmony. Some key informants suggested that there should be concerted efforts to train and retrain the existing cadres of community health workers via the effective implementation of the task shifting policy in Nigeria, in addition to possibly revising the existing training curricula, instead of introducing community midwifery. CONCLUSION: Applying community midwifery within the Nigerian healthcare system has the potential to increase the availability of skilled care during pregnancy, at birth and within postpartum periods, especially in rural communities. However, there needs to be broader stakeholder engagement, more awareness creation and the careful consideration of modalities for introducing and strengthening community midwifery training and practice within the Nigerian health system as well as within the health systems of other developing countries. BioMed Central 2019-12-23 /pmc/articles/PMC6929448/ /pubmed/31870383 http://dx.doi.org/10.1186/s12960-019-0430-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Okereke, Ekechi
Ishaku, Salisu Mohammed
Unumeri, Godwin
Mohammed, Bello
Ahonsi, Babatunde
Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title_full Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title_fullStr Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title_full_unstemmed Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title_short Reducing maternal and newborn mortality in Nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
title_sort reducing maternal and newborn mortality in nigeria—a qualitative study of stakeholders’ perceptions about the performance of community health workers and the introduction of community midwifery at primary healthcare level
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6929448/
https://www.ncbi.nlm.nih.gov/pubmed/31870383
http://dx.doi.org/10.1186/s12960-019-0430-0
work_keys_str_mv AT okerekeekechi reducingmaternalandnewbornmortalityinnigeriaaqualitativestudyofstakeholdersperceptionsabouttheperformanceofcommunityhealthworkersandtheintroductionofcommunitymidwiferyatprimaryhealthcarelevel
AT ishakusalisumohammed reducingmaternalandnewbornmortalityinnigeriaaqualitativestudyofstakeholdersperceptionsabouttheperformanceofcommunityhealthworkersandtheintroductionofcommunitymidwiferyatprimaryhealthcarelevel
AT unumerigodwin reducingmaternalandnewbornmortalityinnigeriaaqualitativestudyofstakeholdersperceptionsabouttheperformanceofcommunityhealthworkersandtheintroductionofcommunitymidwiferyatprimaryhealthcarelevel
AT mohammedbello reducingmaternalandnewbornmortalityinnigeriaaqualitativestudyofstakeholdersperceptionsabouttheperformanceofcommunityhealthworkersandtheintroductionofcommunitymidwiferyatprimaryhealthcarelevel
AT ahonsibabatunde reducingmaternalandnewbornmortalityinnigeriaaqualitativestudyofstakeholdersperceptionsabouttheperformanceofcommunityhealthworkersandtheintroductionofcommunitymidwiferyatprimaryhealthcarelevel