Cargando…
Treating muscle-specific kinase myasthenia gravis from the inside out
| Autores principales: | , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Lippincott Williams & Wilkins
2019
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6935833/ https://www.ncbi.nlm.nih.gov/pubmed/31831572 http://dx.doi.org/10.1212/NXI.0000000000000646 |
| _version_ | 1783483642881769472 |
|---|---|
| author | Huijbers, Maartje G. Verschuuren, Jan J.G.M. |
| author_facet | Huijbers, Maartje G. Verschuuren, Jan J.G.M. |
| author_sort | Huijbers, Maartje G. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6935833 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2019 |
| publisher | Lippincott Williams & Wilkins |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-69358332020-02-10 Treating muscle-specific kinase myasthenia gravis from the inside out Huijbers, Maartje G. Verschuuren, Jan J.G.M. Neurol Neuroimmunol Neuroinflamm Editorial Lippincott Williams & Wilkins 2019-12-12 /pmc/articles/PMC6935833/ /pubmed/31831572 http://dx.doi.org/10.1212/NXI.0000000000000646 Text en Copyright © 2019 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of the American Academy of Neurology. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivatives License 4.0 (CC BY-NC-ND) (http://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits downloading and sharing the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal. |
| spellingShingle | Editorial Huijbers, Maartje G. Verschuuren, Jan J.G.M. Treating muscle-specific kinase myasthenia gravis from the inside out |
| title | Treating muscle-specific kinase myasthenia gravis from the inside out |
| title_full | Treating muscle-specific kinase myasthenia gravis from the inside out |
| title_fullStr | Treating muscle-specific kinase myasthenia gravis from the inside out |
| title_full_unstemmed | Treating muscle-specific kinase myasthenia gravis from the inside out |
| title_short | Treating muscle-specific kinase myasthenia gravis from the inside out |
| title_sort | treating muscle-specific kinase myasthenia gravis from the inside out |
| topic | Editorial |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6935833/ https://www.ncbi.nlm.nih.gov/pubmed/31831572 http://dx.doi.org/10.1212/NXI.0000000000000646 |
| work_keys_str_mv | AT huijbersmaartjeg treatingmusclespecifickinasemyastheniagravisfromtheinsideout AT verschuurenjanjgm treatingmusclespecifickinasemyastheniagravisfromtheinsideout |