Cargando…
Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review
BACKGROUND: Despite impressive reductions in infectious disease burden within Sub-Saharan Africa (SSA), half of the top ten causes of poor health or death in SSA are communicable illnesses. With emerging and re-emerging infections affecting the region, the possibility of healthcare-acquired infectio...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6937686/ https://www.ncbi.nlm.nih.gov/pubmed/31888673 http://dx.doi.org/10.1186/s13012-019-0958-3 |
_version_ | 1783483913628286976 |
---|---|
author | Barrera-Cancedda, Amy Elizabeth Riman, Kathryn A. Shinnick, Julianna E. Buttenheim, Alison M. |
author_facet | Barrera-Cancedda, Amy Elizabeth Riman, Kathryn A. Shinnick, Julianna E. Buttenheim, Alison M. |
author_sort | Barrera-Cancedda, Amy Elizabeth |
collection | PubMed |
description | BACKGROUND: Despite impressive reductions in infectious disease burden within Sub-Saharan Africa (SSA), half of the top ten causes of poor health or death in SSA are communicable illnesses. With emerging and re-emerging infections affecting the region, the possibility of healthcare-acquired infections (HAIs) being transmitted to patients and healthcare workers, especially nurses, is a critical concern. Despite infection prevention and control (IPC) evidence-based practices (EBP) to minimize the transmission of HAIs, many healthcare systems in SSA are challenged to implement them. The purpose of this review is to synthesize and critique what is known about implementation strategies to promote IPC for nurses in SSA. METHODS: The databases, PubMed, Ovid/Medline, Embase, Cochrane, and CINHAL, were searched for articles with the following criteria: English language, peer-reviewed, published between 1998 and 2018, implemented in SSA, targeted nurses, and promoted IPC EBPs. Further, 6241 search results were produced and screened for eligibility to identify implementation strategies used to promote IPC for nurses in SSA. A total of 61 articles met the inclusion criteria for the final review. The articles were evaluated using the Joanna Briggs Institute’s (JBI) quality appraisal tools. Results were reported using PRISMA guidelines. RESULTS: Most studies were conducted in South Africa (n = 18, 30%), within the last 18 years (n = 41, 67%), and utilized a quasi-experimental design (n = 22, 36%). Few studies (n = 14, 23%) had sample populations comprising nurses only. The majority of studies focused on administrative precautions (n = 36, 59%). The most frequent implementation strategies reported were education (n = 59, 97%), quality management (n = 39, 64%), planning (n = 33, 54%), and restructure (n = 32, 53%). Penetration and feasibility were the most common outcomes measured for both EBPs and implementation strategies used to implement the EBPs. The most common MAStARI and MMAT scores were 5 (n = 19, 31%) and 50% (n = 3, 4.9%) respectively. CONCLUSIONS: As infectious diseases, especially emerging and re-emerging infectious diseases, continue to challenge healthcare systems in SSA, nurses, the keystones to IPC practice, need to have a better understanding of which, in what combination, and in what context implementation strategies should be best utilized to ensure their safety and that of their patients. Based on the results of this review, it is clear that implementation of IPC EBPs in SSA requires additional research from an implementation science-specific perspective to promote IPC protocols for nurses in SSA. |
format | Online Article Text |
id | pubmed-6937686 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-69376862019-12-31 Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review Barrera-Cancedda, Amy Elizabeth Riman, Kathryn A. Shinnick, Julianna E. Buttenheim, Alison M. Implement Sci Systematic Review BACKGROUND: Despite impressive reductions in infectious disease burden within Sub-Saharan Africa (SSA), half of the top ten causes of poor health or death in SSA are communicable illnesses. With emerging and re-emerging infections affecting the region, the possibility of healthcare-acquired infections (HAIs) being transmitted to patients and healthcare workers, especially nurses, is a critical concern. Despite infection prevention and control (IPC) evidence-based practices (EBP) to minimize the transmission of HAIs, many healthcare systems in SSA are challenged to implement them. The purpose of this review is to synthesize and critique what is known about implementation strategies to promote IPC for nurses in SSA. METHODS: The databases, PubMed, Ovid/Medline, Embase, Cochrane, and CINHAL, were searched for articles with the following criteria: English language, peer-reviewed, published between 1998 and 2018, implemented in SSA, targeted nurses, and promoted IPC EBPs. Further, 6241 search results were produced and screened for eligibility to identify implementation strategies used to promote IPC for nurses in SSA. A total of 61 articles met the inclusion criteria for the final review. The articles were evaluated using the Joanna Briggs Institute’s (JBI) quality appraisal tools. Results were reported using PRISMA guidelines. RESULTS: Most studies were conducted in South Africa (n = 18, 30%), within the last 18 years (n = 41, 67%), and utilized a quasi-experimental design (n = 22, 36%). Few studies (n = 14, 23%) had sample populations comprising nurses only. The majority of studies focused on administrative precautions (n = 36, 59%). The most frequent implementation strategies reported were education (n = 59, 97%), quality management (n = 39, 64%), planning (n = 33, 54%), and restructure (n = 32, 53%). Penetration and feasibility were the most common outcomes measured for both EBPs and implementation strategies used to implement the EBPs. The most common MAStARI and MMAT scores were 5 (n = 19, 31%) and 50% (n = 3, 4.9%) respectively. CONCLUSIONS: As infectious diseases, especially emerging and re-emerging infectious diseases, continue to challenge healthcare systems in SSA, nurses, the keystones to IPC practice, need to have a better understanding of which, in what combination, and in what context implementation strategies should be best utilized to ensure their safety and that of their patients. Based on the results of this review, it is clear that implementation of IPC EBPs in SSA requires additional research from an implementation science-specific perspective to promote IPC protocols for nurses in SSA. BioMed Central 2019-12-30 /pmc/articles/PMC6937686/ /pubmed/31888673 http://dx.doi.org/10.1186/s13012-019-0958-3 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Systematic Review Barrera-Cancedda, Amy Elizabeth Riman, Kathryn A. Shinnick, Julianna E. Buttenheim, Alison M. Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title | Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title_full | Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title_fullStr | Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title_full_unstemmed | Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title_short | Implementation strategies for infection prevention and control promotion for nurses in Sub-Saharan Africa: a systematic review |
title_sort | implementation strategies for infection prevention and control promotion for nurses in sub-saharan africa: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6937686/ https://www.ncbi.nlm.nih.gov/pubmed/31888673 http://dx.doi.org/10.1186/s13012-019-0958-3 |
work_keys_str_mv | AT barreracanceddaamyelizabeth implementationstrategiesforinfectionpreventionandcontrolpromotionfornursesinsubsaharanafricaasystematicreview AT rimankathryna implementationstrategiesforinfectionpreventionandcontrolpromotionfornursesinsubsaharanafricaasystematicreview AT shinnickjuliannae implementationstrategiesforinfectionpreventionandcontrolpromotionfornursesinsubsaharanafricaasystematicreview AT buttenheimalisonm implementationstrategiesforinfectionpreventionandcontrolpromotionfornursesinsubsaharanafricaasystematicreview |