Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California

We report the complete 4.1-Mb genome sequence of strain BW-2, a magnetotactic, sulfur-oxidizing rod, belonging to the family Ectothiorhodospiraceae of the class Gammaproteobacteria, that biomineralizes membrane-bounded magnetite nanocrystals in its magnetosomes. This genome sequence, in comparison w...

Descripción completa

Detalles Bibliográficos
Autores principales: Geurink, Corey, Lefevre, Christopher T., Monteil, Caroline L., Morillo-Lopez, Viviana, Abreu, Fernanda, Bazylinski, Dennis A., Trubitsyn, Denis
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2020
Materias:
Genome Sequences
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6940282/
https://www.ncbi.nlm.nih.gov/pubmed/31896630
http://dx.doi.org/10.1128/MRA.01144-19
_version_ 1783484320091996160
author Geurink, Corey
Lefevre, Christopher T.
Monteil, Caroline L.
Morillo-Lopez, Viviana
Abreu, Fernanda
Bazylinski, Dennis A.
Trubitsyn, Denis
author_facet Geurink, Corey
Lefevre, Christopher T.
Monteil, Caroline L.
Morillo-Lopez, Viviana
Abreu, Fernanda
Bazylinski, Dennis A.
Trubitsyn, Denis
author_sort Geurink, Corey
collection PubMed
description We report the complete 4.1-Mb genome sequence of strain BW-2, a magnetotactic, sulfur-oxidizing rod, belonging to the family Ectothiorhodospiraceae of the class Gammaproteobacteria, that biomineralizes membrane-bounded magnetite nanocrystals in its magnetosomes. This genome sequence, in comparison with those of other magnetotactic bacteria, is essential for understanding the origin and evolution of magnetotaxis and magnetosome biomineralization.
format Online
Article
Text
id pubmed-6940282
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-69402822020-01-09 Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California Geurink, Corey Lefevre, Christopher T. Monteil, Caroline L. Morillo-Lopez, Viviana Abreu, Fernanda Bazylinski, Dennis A. Trubitsyn, Denis Microbiol Resour Announc Genome Sequences We report the complete 4.1-Mb genome sequence of strain BW-2, a magnetotactic, sulfur-oxidizing rod, belonging to the family Ectothiorhodospiraceae of the class Gammaproteobacteria, that biomineralizes membrane-bounded magnetite nanocrystals in its magnetosomes. This genome sequence, in comparison with those of other magnetotactic bacteria, is essential for understanding the origin and evolution of magnetotaxis and magnetosome biomineralization. American Society for Microbiology 2020-01-02 /pmc/articles/PMC6940282/ /pubmed/31896630 http://dx.doi.org/10.1128/MRA.01144-19 Text en Copyright © 2020 Geurink et al. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Genome Sequences
Geurink, Corey
Lefevre, Christopher T.
Monteil, Caroline L.
Morillo-Lopez, Viviana
Abreu, Fernanda
Bazylinski, Dennis A.
Trubitsyn, Denis
Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title_full Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title_fullStr Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title_full_unstemmed Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title_short Complete Genome Sequence of Strain BW-2, a Magnetotactic Gammaproteobacterium in the Family Ectothiorhodospiraceae, Isolated from a Brackish Spring in Death Valley, California
title_sort complete genome sequence of strain bw-2, a magnetotactic gammaproteobacterium in the family ectothiorhodospiraceae, isolated from a brackish spring in death valley, california
topic Genome Sequences
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6940282/
https://www.ncbi.nlm.nih.gov/pubmed/31896630
http://dx.doi.org/10.1128/MRA.01144-19
work_keys_str_mv AT geurinkcorey completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT lefevrechristophert completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT monteilcarolinel completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT morillolopezviviana completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT abreufernanda completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT bazylinskidennisa completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia
AT trubitsyndenis completegenomesequenceofstrainbw2amagnetotacticgammaproteobacteriuminthefamilyectothiorhodospiraceaeisolatedfromabrackishspringindeathvalleycalifornia

Ejemplares similares