Cargando…
Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review
| Autores principales: | , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2020
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6942344/ https://www.ncbi.nlm.nih.gov/pubmed/31900202 http://dx.doi.org/10.1186/s13054-019-2699-8 |
| _version_ | 1783484685408534528 |
|---|---|
| author | Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek |
| author_facet | Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek |
| author_sort | Tan, Kaiquan |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6942344 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2020 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-69423442020-01-07 Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek Crit Care Correction BioMed Central 2020-01-03 /pmc/articles/PMC6942344/ /pubmed/31900202 http://dx.doi.org/10.1186/s13054-019-2699-8 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Correction Tan, Kaiquan Harazim, Martin Tang, Benjamin Mclean, Anthony Nalos, Marek Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title | Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title_full | Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title_fullStr | Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title_full_unstemmed | Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title_short | Correction to: The association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| title_sort | correction to: the association between premorbid beta blocker exposure and mortality in sepsis—a systematic review |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6942344/ https://www.ncbi.nlm.nih.gov/pubmed/31900202 http://dx.doi.org/10.1186/s13054-019-2699-8 |
| work_keys_str_mv | AT tankaiquan correctiontotheassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT harazimmartin correctiontotheassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT tangbenjamin correctiontotheassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT mcleananthony correctiontotheassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview AT nalosmarek correctiontotheassociationbetweenpremorbidbetablockerexposureandmortalityinsepsisasystematicreview |