What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review

Piglets experience severe growth challenges and diarrhea after weaning due to nutritional, social, psychological, environmental, and physiological changes. Among these changes, the nutritional factor plays a key role in postweaning health. Dietary protein, fibre, starch, and electrolyte levels are h...

Descripción completa

Detalles Bibliográficos
Autores principales: Gao, Jing, Yin, Jie, Xu, Kang, Li, Tiejun, Yin, Yulong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2019
Materias:
Review Article
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6949732/
https://www.ncbi.nlm.nih.gov/pubmed/31976326
http://dx.doi.org/10.1155/2019/6916189
_version_ 1783485938647695360
author Gao, Jing
Yin, Jie
Xu, Kang
Li, Tiejun
Yin, Yulong
author_facet Gao, Jing
Yin, Jie
Xu, Kang
Li, Tiejun
Yin, Yulong
author_sort Gao, Jing
collection PubMed
description Piglets experience severe growth challenges and diarrhea after weaning due to nutritional, social, psychological, environmental, and physiological changes. Among these changes, the nutritional factor plays a key role in postweaning health. Dietary protein, fibre, starch, and electrolyte levels are highly associated with postweaning nutrition diarrhea (PWND). In this review, we mainly discuss the high protein, fibre, resistant starch, and electrolyte imbalance in diets that induce PWND, with a focus on potential mechanisms in weaned piglets.
format Online
Article
Text
id pubmed-6949732
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-69497322020-01-23 What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review Gao, Jing Yin, Jie Xu, Kang Li, Tiejun Yin, Yulong Biomed Res Int Review Article Piglets experience severe growth challenges and diarrhea after weaning due to nutritional, social, psychological, environmental, and physiological changes. Among these changes, the nutritional factor plays a key role in postweaning health. Dietary protein, fibre, starch, and electrolyte levels are highly associated with postweaning nutrition diarrhea (PWND). In this review, we mainly discuss the high protein, fibre, resistant starch, and electrolyte imbalance in diets that induce PWND, with a focus on potential mechanisms in weaned piglets. Hindawi 2019-12-26 /pmc/articles/PMC6949732/ /pubmed/31976326 http://dx.doi.org/10.1155/2019/6916189 Text en Copyright © 2019 Jing Gao et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Article
Gao, Jing
Yin, Jie
Xu, Kang
Li, Tiejun
Yin, Yulong
What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title_full What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title_fullStr What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title_full_unstemmed What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title_short What Is the Impact of Diet on Nutritional Diarrhea Associated with Gut Microbiota in Weaning Piglets: A System Review
title_sort what is the impact of diet on nutritional diarrhea associated with gut microbiota in weaning piglets: a system review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6949732/
https://www.ncbi.nlm.nih.gov/pubmed/31976326
http://dx.doi.org/10.1155/2019/6916189
work_keys_str_mv AT gaojing whatistheimpactofdietonnutritionaldiarrheaassociatedwithgutmicrobiotainweaningpigletsasystemreview
AT yinjie whatistheimpactofdietonnutritionaldiarrheaassociatedwithgutmicrobiotainweaningpigletsasystemreview
AT xukang whatistheimpactofdietonnutritionaldiarrheaassociatedwithgutmicrobiotainweaningpigletsasystemreview
AT litiejun whatistheimpactofdietonnutritionaldiarrheaassociatedwithgutmicrobiotainweaningpigletsasystemreview
AT yinyulong whatistheimpactofdietonnutritionaldiarrheaassociatedwithgutmicrobiotainweaningpigletsasystemreview

Ejemplares similares