Cargando…
Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders
BACKGROUND/AIMS: To determine the value of salivary pepsin in discriminating sub-types of gastroesophageal reflux disease (GERD) and GERD-related disorders. METHODS: Overall, 322 patients with different sub-types of GERD and 45 healthy controls (HC) were studied. All patients took Gastroesophageal R...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Korean Society of Neurogastroenterology and Motility
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6955190/ https://www.ncbi.nlm.nih.gov/pubmed/31650768 http://dx.doi.org/10.5056/jnm19032 |
_version_ | 1783486907140800512 |
---|---|
author | Wang, Yan-Jun Lang, Xiu-Qiong Wu, Dan He, Yu-Qin Lan, Chun-Hui Xiao-Xiao, Wang, Bin Zou, Duo-Wu Wu, Ji-Min Zhao, Yong-Bin Dettmar, Peter W Chen, Dong-Feng Yang, Min |
author_facet | Wang, Yan-Jun Lang, Xiu-Qiong Wu, Dan He, Yu-Qin Lan, Chun-Hui Xiao-Xiao, Wang, Bin Zou, Duo-Wu Wu, Ji-Min Zhao, Yong-Bin Dettmar, Peter W Chen, Dong-Feng Yang, Min |
author_sort | Wang, Yan-Jun |
collection | PubMed |
description | BACKGROUND/AIMS: To determine the value of salivary pepsin in discriminating sub-types of gastroesophageal reflux disease (GERD) and GERD-related disorders. METHODS: Overall, 322 patients with different sub-types of GERD and 45 healthy controls (HC) were studied. All patients took Gastroesophageal Reflux Disease Questionnaire (GerdQ) and underwent endoscopy and 24-hour esophageal pH monitoring and manometry. Salivary pepsin concentration (SPC) was detected by using colloidal gold double-antibody immunological sandwich assay. Oral esomeprazole treatment was administrated in the patients with non-erosive reflux disease (NERD) and extra-esophageal symptoms (EES). RESULTS: Compared to HC, patients with erosive esophagitis, NERD, EES, EES plus typical GERD symptoms, or Barrett’s esophagus had a higher prevalence of saliva and SPC (all P < 0.001). There was no significant difference in the positive rate for pepsin in patients with functional heartburn or GERD with anxiety and depression, compared to HC. After esomeprazole treatment, the positive rate and SPC were significantly reduced in NERD (both P < 0.001) and in EES (P = 0.001 and P = 0.002, respectively). Of the 64 NERD patients, 71.9% (n = 46) were positive for salivary pepsin, which was significantly higher than the rate (43.8%, n = 28) of pathological acid reflux as detected by 24-hour esophageal pH monitoring (P = 0.002). CONCLUSIONS: Salivary pepsin has an important significance for the diagnosis of GERD and GERD-related disorders. Salivary pepsin and 24-hour esophageal pH monitoring may complement with each other to improve the diagnostic efficiency. |
format | Online Article Text |
id | pubmed-6955190 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Korean Society of Neurogastroenterology and Motility |
record_format | MEDLINE/PubMed |
spelling | pubmed-69551902020-01-22 Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders Wang, Yan-Jun Lang, Xiu-Qiong Wu, Dan He, Yu-Qin Lan, Chun-Hui Xiao-Xiao, Wang, Bin Zou, Duo-Wu Wu, Ji-Min Zhao, Yong-Bin Dettmar, Peter W Chen, Dong-Feng Yang, Min J Neurogastroenterol Motil Original Article BACKGROUND/AIMS: To determine the value of salivary pepsin in discriminating sub-types of gastroesophageal reflux disease (GERD) and GERD-related disorders. METHODS: Overall, 322 patients with different sub-types of GERD and 45 healthy controls (HC) were studied. All patients took Gastroesophageal Reflux Disease Questionnaire (GerdQ) and underwent endoscopy and 24-hour esophageal pH monitoring and manometry. Salivary pepsin concentration (SPC) was detected by using colloidal gold double-antibody immunological sandwich assay. Oral esomeprazole treatment was administrated in the patients with non-erosive reflux disease (NERD) and extra-esophageal symptoms (EES). RESULTS: Compared to HC, patients with erosive esophagitis, NERD, EES, EES plus typical GERD symptoms, or Barrett’s esophagus had a higher prevalence of saliva and SPC (all P < 0.001). There was no significant difference in the positive rate for pepsin in patients with functional heartburn or GERD with anxiety and depression, compared to HC. After esomeprazole treatment, the positive rate and SPC were significantly reduced in NERD (both P < 0.001) and in EES (P = 0.001 and P = 0.002, respectively). Of the 64 NERD patients, 71.9% (n = 46) were positive for salivary pepsin, which was significantly higher than the rate (43.8%, n = 28) of pathological acid reflux as detected by 24-hour esophageal pH monitoring (P = 0.002). CONCLUSIONS: Salivary pepsin has an important significance for the diagnosis of GERD and GERD-related disorders. Salivary pepsin and 24-hour esophageal pH monitoring may complement with each other to improve the diagnostic efficiency. Korean Society of Neurogastroenterology and Motility 2020-01 2020-01-30 /pmc/articles/PMC6955190/ /pubmed/31650768 http://dx.doi.org/10.5056/jnm19032 Text en © 2020 The Korean Society of Neurogastroenterology and Motility This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Wang, Yan-Jun Lang, Xiu-Qiong Wu, Dan He, Yu-Qin Lan, Chun-Hui Xiao-Xiao, Wang, Bin Zou, Duo-Wu Wu, Ji-Min Zhao, Yong-Bin Dettmar, Peter W Chen, Dong-Feng Yang, Min Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title | Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title_full | Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title_fullStr | Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title_full_unstemmed | Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title_short | Salivary Pepsin as an Intrinsic Marker for Diagnosis of Sub-types of Gastroesophageal Reflux Disease and Gastroesophageal Reflux Disease-related Disorders |
title_sort | salivary pepsin as an intrinsic marker for diagnosis of sub-types of gastroesophageal reflux disease and gastroesophageal reflux disease-related disorders |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6955190/ https://www.ncbi.nlm.nih.gov/pubmed/31650768 http://dx.doi.org/10.5056/jnm19032 |
work_keys_str_mv | AT wangyanjun salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT langxiuqiong salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT wudan salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT heyuqin salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT lanchunhui salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT xiaoxiao salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT wangbin salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT zouduowu salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT wujimin salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT zhaoyongbin salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT dettmarpeterw salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT chendongfeng salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders AT yangmin salivarypepsinasanintrinsicmarkerfordiagnosisofsubtypesofgastroesophagealrefluxdiseaseandgastroesophagealrefluxdiseaserelateddisorders |