Cargando…

The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding

Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, whic...

Descripción completa

Detalles Bibliográficos
Autores principales: Blisnick, Adrien A., Šimo, Ladislav, Grillon, Catherine, Fasani, Fabienne, Brûlé, Sébastien, Le Bonniec, Bernard, Prina, Eric, Marsot, Maud, Relmy, Anthony, Blaise-Boisseau, Sandra, Richardson, Jennifer, Bonnet, Sarah I.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6963187/
https://www.ncbi.nlm.nih.gov/pubmed/31614804
http://dx.doi.org/10.3390/vaccines7040148
_version_ 1783488228697833472
author Blisnick, Adrien A.
Šimo, Ladislav
Grillon, Catherine
Fasani, Fabienne
Brûlé, Sébastien
Le Bonniec, Bernard
Prina, Eric
Marsot, Maud
Relmy, Anthony
Blaise-Boisseau, Sandra
Richardson, Jennifer
Bonnet, Sarah I.
author_facet Blisnick, Adrien A.
Šimo, Ladislav
Grillon, Catherine
Fasani, Fabienne
Brûlé, Sébastien
Le Bonniec, Bernard
Prina, Eric
Marsot, Maud
Relmy, Anthony
Blaise-Boisseau, Sandra
Richardson, Jennifer
Bonnet, Sarah I.
author_sort Blisnick, Adrien A.
collection PubMed
description Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, which not only controls host hemostasis and wound healing, but also subverts the host immune response to avoid tick rejection that creates a favorable niche for the survival and propagation of diverse tick-borne pathogens. Here, we report on the molecular and biochemical features and functions of an Ixodes ricinus serine protease inhibitor (IrSPI). We characterize IrSPI as a Kunitz elastase inhibitor that is overexpressed in several tick organs—especially salivary glands—during blood-feeding. We also demonstrated that when IrSPI is injected into the host through saliva, it had no impact on tissue factor pathway-induced coagulation, fibrinolysis, endothelial cell angiogenesis or apoptosis, but the protein exhibits immunomodulatory activity. In particular, IrSPI represses proliferation of CD4(+) T lymphocytes and proinflammatory cytokine secretion from both splenocytes and macrophages. Our study contributes valuable knowledge to tick-host interactions and provides insights that could be further exploited to design anti-tick vaccines targeting this immunomodulator implicated in I. ricinus feeding.
format Online
Article
Text
id pubmed-6963187
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-69631872020-01-27 The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding Blisnick, Adrien A. Šimo, Ladislav Grillon, Catherine Fasani, Fabienne Brûlé, Sébastien Le Bonniec, Bernard Prina, Eric Marsot, Maud Relmy, Anthony Blaise-Boisseau, Sandra Richardson, Jennifer Bonnet, Sarah I. Vaccines (Basel) Article Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, which not only controls host hemostasis and wound healing, but also subverts the host immune response to avoid tick rejection that creates a favorable niche for the survival and propagation of diverse tick-borne pathogens. Here, we report on the molecular and biochemical features and functions of an Ixodes ricinus serine protease inhibitor (IrSPI). We characterize IrSPI as a Kunitz elastase inhibitor that is overexpressed in several tick organs—especially salivary glands—during blood-feeding. We also demonstrated that when IrSPI is injected into the host through saliva, it had no impact on tissue factor pathway-induced coagulation, fibrinolysis, endothelial cell angiogenesis or apoptosis, but the protein exhibits immunomodulatory activity. In particular, IrSPI represses proliferation of CD4(+) T lymphocytes and proinflammatory cytokine secretion from both splenocytes and macrophages. Our study contributes valuable knowledge to tick-host interactions and provides insights that could be further exploited to design anti-tick vaccines targeting this immunomodulator implicated in I. ricinus feeding. MDPI 2019-10-12 /pmc/articles/PMC6963187/ /pubmed/31614804 http://dx.doi.org/10.3390/vaccines7040148 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Blisnick, Adrien A.
Šimo, Ladislav
Grillon, Catherine
Fasani, Fabienne
Brûlé, Sébastien
Le Bonniec, Bernard
Prina, Eric
Marsot, Maud
Relmy, Anthony
Blaise-Boisseau, Sandra
Richardson, Jennifer
Bonnet, Sarah I.
The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title_full The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title_fullStr The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title_full_unstemmed The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title_short The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
title_sort immunomodulatory effect of irspi, a tick salivary gland serine protease inhibitor involved in ixodes ricinus tick feeding
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6963187/
https://www.ncbi.nlm.nih.gov/pubmed/31614804
http://dx.doi.org/10.3390/vaccines7040148
work_keys_str_mv AT blisnickadriena theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT simoladislav theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT grilloncatherine theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT fasanifabienne theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT brulesebastien theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT lebonniecbernard theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT prinaeric theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT marsotmaud theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT relmyanthony theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT blaiseboisseausandra theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT richardsonjennifer theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT bonnetsarahi theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT blisnickadriena immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT simoladislav immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT grilloncatherine immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT fasanifabienne immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT brulesebastien immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT lebonniecbernard immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT prinaeric immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT marsotmaud immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT relmyanthony immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT blaiseboisseausandra immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT richardsonjennifer immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding
AT bonnetsarahi immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding