Cargando…
The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding
Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, whic...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6963187/ https://www.ncbi.nlm.nih.gov/pubmed/31614804 http://dx.doi.org/10.3390/vaccines7040148 |
_version_ | 1783488228697833472 |
---|---|
author | Blisnick, Adrien A. Šimo, Ladislav Grillon, Catherine Fasani, Fabienne Brûlé, Sébastien Le Bonniec, Bernard Prina, Eric Marsot, Maud Relmy, Anthony Blaise-Boisseau, Sandra Richardson, Jennifer Bonnet, Sarah I. |
author_facet | Blisnick, Adrien A. Šimo, Ladislav Grillon, Catherine Fasani, Fabienne Brûlé, Sébastien Le Bonniec, Bernard Prina, Eric Marsot, Maud Relmy, Anthony Blaise-Boisseau, Sandra Richardson, Jennifer Bonnet, Sarah I. |
author_sort | Blisnick, Adrien A. |
collection | PubMed |
description | Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, which not only controls host hemostasis and wound healing, but also subverts the host immune response to avoid tick rejection that creates a favorable niche for the survival and propagation of diverse tick-borne pathogens. Here, we report on the molecular and biochemical features and functions of an Ixodes ricinus serine protease inhibitor (IrSPI). We characterize IrSPI as a Kunitz elastase inhibitor that is overexpressed in several tick organs—especially salivary glands—during blood-feeding. We also demonstrated that when IrSPI is injected into the host through saliva, it had no impact on tissue factor pathway-induced coagulation, fibrinolysis, endothelial cell angiogenesis or apoptosis, but the protein exhibits immunomodulatory activity. In particular, IrSPI represses proliferation of CD4(+) T lymphocytes and proinflammatory cytokine secretion from both splenocytes and macrophages. Our study contributes valuable knowledge to tick-host interactions and provides insights that could be further exploited to design anti-tick vaccines targeting this immunomodulator implicated in I. ricinus feeding. |
format | Online Article Text |
id | pubmed-6963187 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-69631872020-01-27 The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding Blisnick, Adrien A. Šimo, Ladislav Grillon, Catherine Fasani, Fabienne Brûlé, Sébastien Le Bonniec, Bernard Prina, Eric Marsot, Maud Relmy, Anthony Blaise-Boisseau, Sandra Richardson, Jennifer Bonnet, Sarah I. Vaccines (Basel) Article Ticks are the most important vectors of pathogens affecting both domestic and wild animals worldwide. Hard tick feeding is a slow process—taking up to several days—and necessitates extended control over the host response. The success of the feeding process depends upon injection of tick saliva, which not only controls host hemostasis and wound healing, but also subverts the host immune response to avoid tick rejection that creates a favorable niche for the survival and propagation of diverse tick-borne pathogens. Here, we report on the molecular and biochemical features and functions of an Ixodes ricinus serine protease inhibitor (IrSPI). We characterize IrSPI as a Kunitz elastase inhibitor that is overexpressed in several tick organs—especially salivary glands—during blood-feeding. We also demonstrated that when IrSPI is injected into the host through saliva, it had no impact on tissue factor pathway-induced coagulation, fibrinolysis, endothelial cell angiogenesis or apoptosis, but the protein exhibits immunomodulatory activity. In particular, IrSPI represses proliferation of CD4(+) T lymphocytes and proinflammatory cytokine secretion from both splenocytes and macrophages. Our study contributes valuable knowledge to tick-host interactions and provides insights that could be further exploited to design anti-tick vaccines targeting this immunomodulator implicated in I. ricinus feeding. MDPI 2019-10-12 /pmc/articles/PMC6963187/ /pubmed/31614804 http://dx.doi.org/10.3390/vaccines7040148 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Blisnick, Adrien A. Šimo, Ladislav Grillon, Catherine Fasani, Fabienne Brûlé, Sébastien Le Bonniec, Bernard Prina, Eric Marsot, Maud Relmy, Anthony Blaise-Boisseau, Sandra Richardson, Jennifer Bonnet, Sarah I. The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title | The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title_full | The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title_fullStr | The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title_full_unstemmed | The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title_short | The Immunomodulatory Effect of IrSPI, a Tick Salivary Gland Serine Protease Inhibitor Involved in Ixodes ricinus Tick Feeding |
title_sort | immunomodulatory effect of irspi, a tick salivary gland serine protease inhibitor involved in ixodes ricinus tick feeding |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6963187/ https://www.ncbi.nlm.nih.gov/pubmed/31614804 http://dx.doi.org/10.3390/vaccines7040148 |
work_keys_str_mv | AT blisnickadriena theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT simoladislav theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT grilloncatherine theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT fasanifabienne theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT brulesebastien theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT lebonniecbernard theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT prinaeric theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT marsotmaud theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT relmyanthony theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT blaiseboisseausandra theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT richardsonjennifer theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT bonnetsarahi theimmunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT blisnickadriena immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT simoladislav immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT grilloncatherine immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT fasanifabienne immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT brulesebastien immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT lebonniecbernard immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT prinaeric immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT marsotmaud immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT relmyanthony immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT blaiseboisseausandra immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT richardsonjennifer immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding AT bonnetsarahi immunomodulatoryeffectofirspiaticksalivaryglandserineproteaseinhibitorinvolvedinixodesricinustickfeeding |