Cargando…
Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat
Patients with hypoglycemic coma show abnormal signals in the white matter on magnetic resonance imaging. However, the precise pathological changes in the white matter caused by hypoglycemic coma remain unclear in humans and experimental animals. This study aimed to reveal the distribution and time c...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Japanese Society of Veterinary Science
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6983658/ https://www.ncbi.nlm.nih.gov/pubmed/31787662 http://dx.doi.org/10.1292/jvms.19-0502 |
_version_ | 1783491543026368512 |
---|---|
author | TOMITA, Nagi NAKAMURA, Tomoki SUNDEN, Yuji MORITA, Takehito |
author_facet | TOMITA, Nagi NAKAMURA, Tomoki SUNDEN, Yuji MORITA, Takehito |
author_sort | TOMITA, Nagi |
collection | PubMed |
description | Patients with hypoglycemic coma show abnormal signals in the white matter on magnetic resonance imaging. However, the precise pathological changes in the white matter caused by hypoglycemic coma remain unclear in humans and experimental animals. This study aimed to reveal the distribution and time course of histopathological and immunohistochemical changes occurring in the white matter during the early stages of hypoglycemic coma in rats. Insulin-induced hypoglycemic coma of 15–30-min duration was induced in rats, followed by recovery using a glucose solution. Rat brains were collected after 6 and 24 hr and after 3, 5, 7, and 14 days. The brains were submitted for histological and immunohistochemical analysis for neurofilament 200 kDa (NF), myelin basic protein, olig-2, Iba-1, and glial fibrillary acidic protein (GFAP). Vacuolation was observed in the fiber bundles of the globus pallidus on days 1–14. Most of the vacuoles were located in GFAP-positive astrocytic processes or the extracellular space and appeared to be edematous. Additionally, myelin pallor and a decrease in NF-positive signals were observed on day 14. Microgliosis and astrogliosis were also detected. Observations similar to the globus pallidus, except for edema, were noted in the internal capsule. In the corpus callosum, a mild decrease in NF-positive signals, microgliosis, and astrogliosis were observed. These results suggest that after transient hypoglycemic coma, edema and/or degeneration occurred in the white matter, especially in the globus pallidus, internal capsule, and corpus callosum in the early stages. |
format | Online Article Text |
id | pubmed-6983658 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | The Japanese Society of Veterinary Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-69836582020-01-30 Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat TOMITA, Nagi NAKAMURA, Tomoki SUNDEN, Yuji MORITA, Takehito J Vet Med Sci Pathology Patients with hypoglycemic coma show abnormal signals in the white matter on magnetic resonance imaging. However, the precise pathological changes in the white matter caused by hypoglycemic coma remain unclear in humans and experimental animals. This study aimed to reveal the distribution and time course of histopathological and immunohistochemical changes occurring in the white matter during the early stages of hypoglycemic coma in rats. Insulin-induced hypoglycemic coma of 15–30-min duration was induced in rats, followed by recovery using a glucose solution. Rat brains were collected after 6 and 24 hr and after 3, 5, 7, and 14 days. The brains were submitted for histological and immunohistochemical analysis for neurofilament 200 kDa (NF), myelin basic protein, olig-2, Iba-1, and glial fibrillary acidic protein (GFAP). Vacuolation was observed in the fiber bundles of the globus pallidus on days 1–14. Most of the vacuoles were located in GFAP-positive astrocytic processes or the extracellular space and appeared to be edematous. Additionally, myelin pallor and a decrease in NF-positive signals were observed on day 14. Microgliosis and astrogliosis were also detected. Observations similar to the globus pallidus, except for edema, were noted in the internal capsule. In the corpus callosum, a mild decrease in NF-positive signals, microgliosis, and astrogliosis were observed. These results suggest that after transient hypoglycemic coma, edema and/or degeneration occurred in the white matter, especially in the globus pallidus, internal capsule, and corpus callosum in the early stages. The Japanese Society of Veterinary Science 2019-12-02 2020-01 /pmc/articles/PMC6983658/ /pubmed/31787662 http://dx.doi.org/10.1292/jvms.19-0502 Text en ©2020 The Japanese Society of Veterinary Science This is an open-access article distributed under the terms of the Creative Commons Attribution Non-Commercial No Derivatives (by-nc-nd) License. (CC-BY-NC-ND 4.0: https://creativecommons.org/licenses/by-nc-nd/4.0/) |
spellingShingle | Pathology TOMITA, Nagi NAKAMURA, Tomoki SUNDEN, Yuji MORITA, Takehito Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title | Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title_full | Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title_fullStr | Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title_full_unstemmed | Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title_short | Histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
title_sort | histopathological and immunohistochemical analysis of the cerebral white matter after transient hypoglycemia in rat |
topic | Pathology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6983658/ https://www.ncbi.nlm.nih.gov/pubmed/31787662 http://dx.doi.org/10.1292/jvms.19-0502 |
work_keys_str_mv | AT tomitanagi histopathologicalandimmunohistochemicalanalysisofthecerebralwhitematteraftertransienthypoglycemiainrat AT nakamuratomoki histopathologicalandimmunohistochemicalanalysisofthecerebralwhitematteraftertransienthypoglycemiainrat AT sundenyuji histopathologicalandimmunohistochemicalanalysisofthecerebralwhitematteraftertransienthypoglycemiainrat AT moritatakehito histopathologicalandimmunohistochemicalanalysisofthecerebralwhitematteraftertransienthypoglycemiainrat |