Cargando…

Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania

BACKGROUND: In sub-Saharan Africa, women are most likely to receive skilled and adequate childbirth care in hospital settings, yet the use of hospital for childbirth is low and inequitable. The poorest and those living furthest away from a hospital are most affected. But the relative contribution of...

Descripción completa

Detalles Bibliográficos
Autores principales: Wong, Kerry L. M., Brady, Oliver J., Campbell, Oona M. R., Banke-Thomas, Aduragbemi, Benova, Lenka
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6988213/
https://www.ncbi.nlm.nih.gov/pubmed/31992319
http://dx.doi.org/10.1186/s12939-020-1123-y
_version_ 1783492219413463040
author Wong, Kerry L. M.
Brady, Oliver J.
Campbell, Oona M. R.
Banke-Thomas, Aduragbemi
Benova, Lenka
author_facet Wong, Kerry L. M.
Brady, Oliver J.
Campbell, Oona M. R.
Banke-Thomas, Aduragbemi
Benova, Lenka
author_sort Wong, Kerry L. M.
collection PubMed
description BACKGROUND: In sub-Saharan Africa, women are most likely to receive skilled and adequate childbirth care in hospital settings, yet the use of hospital for childbirth is low and inequitable. The poorest and those living furthest away from a hospital are most affected. But the relative contribution of poverty and travel time is convoluted, since hospitals are often located in wealthier urban places and are scarcer in poorer remote area. This study aims to partition the variability in hospital-based childbirth by poverty and travel time in four sub-Saharan African countries. METHODS: We used data from the most recent Demographic and Health Survey in Kenya, Malawi, Nigeria and Tanzania. For each country, geographic coordinates of survey clusters, the master list of hospital locations and a high-resolution map of land surface friction were used to estimate travel time from each DHS cluster to the nearest hospital with a shortest-path algorithm. We quantified and compared the predicted probabilities of hospital-based childbirth resulting from one standard deviation (SD) change around the mean for different model predictors. RESULTS: The mean travel time to the nearest hospital, in minutes, was 27 (Kenya), 31 (Malawi), 25 (Nigeria) and 62 (Tanzania). In Kenya, a change of 1SD in wealth led to a 33.2 percentage points change in the probability of hospital birth, whereas a 1SD change in travel time led to a change of 16.6 percentage points. The marginal effect of 1SD change in wealth was weaker than that of travel time in Malawi (13.1 vs. 34.0 percentage points) and Tanzania (20.4 vs. 33.7 percentage points). In Nigeria, the two were similar (22.3 vs. 24.8 percentage points) but their additive effect was twice stronger (44.6 percentage points) than the separate effects. Random effects from survey clusters also explained substantial variability in hospital-based childbirth in all countries, indicating other unobserved local factors at play. CONCLUSIONS: Both poverty and long travel time are important determinants of hospital birth, although they vary in the extent to which they influence whether women give birth in a hospital within and across countries. This suggests that different strategies are needed to effectively enable poor women and women living in remote areas to gain access to skilled and adequate care for childbirth.
format Online
Article
Text
id pubmed-6988213
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-69882132020-01-31 Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania Wong, Kerry L. M. Brady, Oliver J. Campbell, Oona M. R. Banke-Thomas, Aduragbemi Benova, Lenka Int J Equity Health Research BACKGROUND: In sub-Saharan Africa, women are most likely to receive skilled and adequate childbirth care in hospital settings, yet the use of hospital for childbirth is low and inequitable. The poorest and those living furthest away from a hospital are most affected. But the relative contribution of poverty and travel time is convoluted, since hospitals are often located in wealthier urban places and are scarcer in poorer remote area. This study aims to partition the variability in hospital-based childbirth by poverty and travel time in four sub-Saharan African countries. METHODS: We used data from the most recent Demographic and Health Survey in Kenya, Malawi, Nigeria and Tanzania. For each country, geographic coordinates of survey clusters, the master list of hospital locations and a high-resolution map of land surface friction were used to estimate travel time from each DHS cluster to the nearest hospital with a shortest-path algorithm. We quantified and compared the predicted probabilities of hospital-based childbirth resulting from one standard deviation (SD) change around the mean for different model predictors. RESULTS: The mean travel time to the nearest hospital, in minutes, was 27 (Kenya), 31 (Malawi), 25 (Nigeria) and 62 (Tanzania). In Kenya, a change of 1SD in wealth led to a 33.2 percentage points change in the probability of hospital birth, whereas a 1SD change in travel time led to a change of 16.6 percentage points. The marginal effect of 1SD change in wealth was weaker than that of travel time in Malawi (13.1 vs. 34.0 percentage points) and Tanzania (20.4 vs. 33.7 percentage points). In Nigeria, the two were similar (22.3 vs. 24.8 percentage points) but their additive effect was twice stronger (44.6 percentage points) than the separate effects. Random effects from survey clusters also explained substantial variability in hospital-based childbirth in all countries, indicating other unobserved local factors at play. CONCLUSIONS: Both poverty and long travel time are important determinants of hospital birth, although they vary in the extent to which they influence whether women give birth in a hospital within and across countries. This suggests that different strategies are needed to effectively enable poor women and women living in remote areas to gain access to skilled and adequate care for childbirth. BioMed Central 2020-01-28 /pmc/articles/PMC6988213/ /pubmed/31992319 http://dx.doi.org/10.1186/s12939-020-1123-y Text en © The Author(s). 2020 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Wong, Kerry L. M.
Brady, Oliver J.
Campbell, Oona M. R.
Banke-Thomas, Aduragbemi
Benova, Lenka
Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title_full Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title_fullStr Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title_full_unstemmed Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title_short Too poor or too far? Partitioning the variability of hospital-based childbirth by poverty and travel time in Kenya, Malawi, Nigeria and Tanzania
title_sort too poor or too far? partitioning the variability of hospital-based childbirth by poverty and travel time in kenya, malawi, nigeria and tanzania
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6988213/
https://www.ncbi.nlm.nih.gov/pubmed/31992319
http://dx.doi.org/10.1186/s12939-020-1123-y
work_keys_str_mv AT wongkerrylm toopoorortoofarpartitioningthevariabilityofhospitalbasedchildbirthbypovertyandtraveltimeinkenyamalawinigeriaandtanzania
AT bradyoliverj toopoorortoofarpartitioningthevariabilityofhospitalbasedchildbirthbypovertyandtraveltimeinkenyamalawinigeriaandtanzania
AT campbelloonamr toopoorortoofarpartitioningthevariabilityofhospitalbasedchildbirthbypovertyandtraveltimeinkenyamalawinigeriaandtanzania
AT bankethomasaduragbemi toopoorortoofarpartitioningthevariabilityofhospitalbasedchildbirthbypovertyandtraveltimeinkenyamalawinigeriaandtanzania
AT benovalenka toopoorortoofarpartitioningthevariabilityofhospitalbasedchildbirthbypovertyandtraveltimeinkenyamalawinigeriaandtanzania