Cargando…
Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya
BACKGROUND: Kaposi’s sarcoma (KS) is one of the most common HIV-associated malignancies in sub-Saharan Africa. Worldwide, the availability of antiretroviral therapy (ART) has improved KS survival. In resource-rich settings, survival has also benefited from chemotherapy, which is widely available. Li...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6990575/ https://www.ncbi.nlm.nih.gov/pubmed/31996161 http://dx.doi.org/10.1186/s12885-019-6506-3 |
_version_ | 1783492531385794560 |
---|---|
author | Freeman, Esther E. Busakhala, Naftali Regan, Susan Asirwa, Fredrick Chite Wenger, Megan Seth, Divya Moon, Khatiya Chelidze Semeere, Aggrey Maurer, Toby Wools-Kaloustian, Kara Bassett, Ingrid Martin, Jeffrey |
author_facet | Freeman, Esther E. Busakhala, Naftali Regan, Susan Asirwa, Fredrick Chite Wenger, Megan Seth, Divya Moon, Khatiya Chelidze Semeere, Aggrey Maurer, Toby Wools-Kaloustian, Kara Bassett, Ingrid Martin, Jeffrey |
author_sort | Freeman, Esther E. |
collection | PubMed |
description | BACKGROUND: Kaposi’s sarcoma (KS) is one of the most common HIV-associated malignancies in sub-Saharan Africa. Worldwide, the availability of antiretroviral therapy (ART) has improved KS survival. In resource-rich settings, survival has also benefited from chemotherapy, which is widely available. Little is known, however, about the epidemiology of chemotherapy use for HIV-associated KS in resource-limited regions such as sub-Saharan Africa. METHODS: We identified all patients newly diagnosed with HIV-related KS from 2009 to 2012 in the 26-clinic AMPATH network, a large community-based care network in Kenya. We ascertained disease severity at diagnosis, frequency of initiation of chemotherapy, and distribution of chemotherapeutic regimens used. Indications for chemotherapy included AIDS Clinical Trial Group T1 stage and/or “severe” disease defined by WHO KS treatment guidelines. RESULTS: Of 674 patients diagnosed with KS, charts were available for 588; 61% were men, median age was 35 years, and median CD4 at KS diagnosis was 185 cells/μl. At time of diagnosis, 58% had at least one chemotherapy indication, and 22% had more than one indication. For patients with a chemotherapy indication, cumulative incidence of chemotherapy initiation (with death as a competing event) was 37% by 1 month and 56% by 1 year. Median time from diagnosis to chemotherapy initiation was 25 days (IQR 1–50 days). In multivariable regression, patients with > 3 chemotherapy indications at time of diagnosis had a 2.30 (95% CI 1.46–3.60) increased risk of rapid chemotherapy initiation (within 30 days of diagnosis) compared to those with only one chemotherapy indication (p < 0.001). Initial regimens were bleomycin-vincristine (78%), adriamycin-bleomycin-vincristine (11%), etoposide (7%), and gemcitabine (4%). CONCLUSIONS: A substantial fraction of patients with KS in East Africa are diagnosed at advanced disease stage. For patients with chemotherapy indications, nearly half did not receive chemotherapy by one year. Liposomal anthracyclines, often used in resource-rich settings, were not first line. These findings emphasize challenges in East Africa cancer care, and highlight the need for further advocacy for improved access to higher quality chemotherapy in this setting. |
format | Online Article Text |
id | pubmed-6990575 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-69905752020-02-04 Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya Freeman, Esther E. Busakhala, Naftali Regan, Susan Asirwa, Fredrick Chite Wenger, Megan Seth, Divya Moon, Khatiya Chelidze Semeere, Aggrey Maurer, Toby Wools-Kaloustian, Kara Bassett, Ingrid Martin, Jeffrey BMC Cancer Research Article BACKGROUND: Kaposi’s sarcoma (KS) is one of the most common HIV-associated malignancies in sub-Saharan Africa. Worldwide, the availability of antiretroviral therapy (ART) has improved KS survival. In resource-rich settings, survival has also benefited from chemotherapy, which is widely available. Little is known, however, about the epidemiology of chemotherapy use for HIV-associated KS in resource-limited regions such as sub-Saharan Africa. METHODS: We identified all patients newly diagnosed with HIV-related KS from 2009 to 2012 in the 26-clinic AMPATH network, a large community-based care network in Kenya. We ascertained disease severity at diagnosis, frequency of initiation of chemotherapy, and distribution of chemotherapeutic regimens used. Indications for chemotherapy included AIDS Clinical Trial Group T1 stage and/or “severe” disease defined by WHO KS treatment guidelines. RESULTS: Of 674 patients diagnosed with KS, charts were available for 588; 61% were men, median age was 35 years, and median CD4 at KS diagnosis was 185 cells/μl. At time of diagnosis, 58% had at least one chemotherapy indication, and 22% had more than one indication. For patients with a chemotherapy indication, cumulative incidence of chemotherapy initiation (with death as a competing event) was 37% by 1 month and 56% by 1 year. Median time from diagnosis to chemotherapy initiation was 25 days (IQR 1–50 days). In multivariable regression, patients with > 3 chemotherapy indications at time of diagnosis had a 2.30 (95% CI 1.46–3.60) increased risk of rapid chemotherapy initiation (within 30 days of diagnosis) compared to those with only one chemotherapy indication (p < 0.001). Initial regimens were bleomycin-vincristine (78%), adriamycin-bleomycin-vincristine (11%), etoposide (7%), and gemcitabine (4%). CONCLUSIONS: A substantial fraction of patients with KS in East Africa are diagnosed at advanced disease stage. For patients with chemotherapy indications, nearly half did not receive chemotherapy by one year. Liposomal anthracyclines, often used in resource-rich settings, were not first line. These findings emphasize challenges in East Africa cancer care, and highlight the need for further advocacy for improved access to higher quality chemotherapy in this setting. BioMed Central 2020-01-29 /pmc/articles/PMC6990575/ /pubmed/31996161 http://dx.doi.org/10.1186/s12885-019-6506-3 Text en © The Author(s). 2020 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Freeman, Esther E. Busakhala, Naftali Regan, Susan Asirwa, Fredrick Chite Wenger, Megan Seth, Divya Moon, Khatiya Chelidze Semeere, Aggrey Maurer, Toby Wools-Kaloustian, Kara Bassett, Ingrid Martin, Jeffrey Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title | Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title_full | Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title_fullStr | Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title_full_unstemmed | Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title_short | Real-world use of chemotherapy for Kaposi’s sarcoma in a large community-based HIV primary care system in Kenya |
title_sort | real-world use of chemotherapy for kaposi’s sarcoma in a large community-based hiv primary care system in kenya |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6990575/ https://www.ncbi.nlm.nih.gov/pubmed/31996161 http://dx.doi.org/10.1186/s12885-019-6506-3 |
work_keys_str_mv | AT freemanesthere realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT busakhalanaftali realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT regansusan realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT asirwafredrickchite realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT wengermegan realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT sethdivya realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT moonkhatiyachelidze realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT semeereaggrey realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT maurertoby realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT woolskaloustiankara realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT bassettingrid realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya AT martinjeffrey realworlduseofchemotherapyforkaposissarcomainalargecommunitybasedhivprimarycaresysteminkenya |