Cargando…

Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food

The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the cu...

Descripción completa

Detalles Bibliográficos
Autores principales: Hornborg, Sara, Främberg, Anton
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer US 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7007883/
https://www.ncbi.nlm.nih.gov/pubmed/31858173
http://dx.doi.org/10.1007/s00267-019-01241-z
_version_ 1783495377256710144
author Hornborg, Sara
Främberg, Anton
author_facet Hornborg, Sara
Främberg, Anton
author_sort Hornborg, Sara
collection PubMed
description The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the current dietary advice is to increase consumption. Freshwater fisheries have in general been paid less attention in food security discussions. Carp fishes (Cyprinidae) in Sweden have lost their historical value and are currently, both understudied and underutilized. Here we use a combined environmental assessment approach to examine the environmental sustainability of current and potential cyprinid fisheries. We found that current commercial fisheries for Swedish cyprinids in lakes have an average carbon footprint of 0.77 kg CO(2)e per kg of edible product, substantially smaller than most of the popular marine and terrestrial protein sources consumed in Sweden today. This could be even lower if cyprinid resources were better utilized than currently. The cyprinids however exhibited different vulnerability to fishing pressure and are today associated with data deficiencies. Hence, it is currently uncertain how much food for human consumption they can contribute to. Improved consumer interest and management attention is needed, but to the Swedish diet, cyprinids offer a promising opportunity for future more sustainable and nutritious food systems.
format Online
Article
Text
id pubmed-7007883
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Springer US
record_format MEDLINE/PubMed
spelling pubmed-70078832020-02-24 Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food Hornborg, Sara Främberg, Anton Environ Manage Article The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the current dietary advice is to increase consumption. Freshwater fisheries have in general been paid less attention in food security discussions. Carp fishes (Cyprinidae) in Sweden have lost their historical value and are currently, both understudied and underutilized. Here we use a combined environmental assessment approach to examine the environmental sustainability of current and potential cyprinid fisheries. We found that current commercial fisheries for Swedish cyprinids in lakes have an average carbon footprint of 0.77 kg CO(2)e per kg of edible product, substantially smaller than most of the popular marine and terrestrial protein sources consumed in Sweden today. This could be even lower if cyprinid resources were better utilized than currently. The cyprinids however exhibited different vulnerability to fishing pressure and are today associated with data deficiencies. Hence, it is currently uncertain how much food for human consumption they can contribute to. Improved consumer interest and management attention is needed, but to the Swedish diet, cyprinids offer a promising opportunity for future more sustainable and nutritious food systems. Springer US 2019-12-19 2020 /pmc/articles/PMC7007883/ /pubmed/31858173 http://dx.doi.org/10.1007/s00267-019-01241-z Text en © The Author(s) 2020 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.
spellingShingle Article
Hornborg, Sara
Främberg, Anton
Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title_full Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title_fullStr Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title_full_unstemmed Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title_short Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
title_sort carp (cyprinidae) fisheries in swedish lakes: a combined environmental assessment approach to evaluate data-limited freshwater fish resources as food
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7007883/
https://www.ncbi.nlm.nih.gov/pubmed/31858173
http://dx.doi.org/10.1007/s00267-019-01241-z
work_keys_str_mv AT hornborgsara carpcyprinidaefisheriesinswedishlakesacombinedenvironmentalassessmentapproachtoevaluatedatalimitedfreshwaterfishresourcesasfood
AT framberganton carpcyprinidaefisheriesinswedishlakesacombinedenvironmentalassessmentapproachtoevaluatedatalimitedfreshwaterfishresourcesasfood