Cargando…
Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food
The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the cu...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7007883/ https://www.ncbi.nlm.nih.gov/pubmed/31858173 http://dx.doi.org/10.1007/s00267-019-01241-z |
_version_ | 1783495377256710144 |
---|---|
author | Hornborg, Sara Främberg, Anton |
author_facet | Hornborg, Sara Främberg, Anton |
author_sort | Hornborg, Sara |
collection | PubMed |
description | The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the current dietary advice is to increase consumption. Freshwater fisheries have in general been paid less attention in food security discussions. Carp fishes (Cyprinidae) in Sweden have lost their historical value and are currently, both understudied and underutilized. Here we use a combined environmental assessment approach to examine the environmental sustainability of current and potential cyprinid fisheries. We found that current commercial fisheries for Swedish cyprinids in lakes have an average carbon footprint of 0.77 kg CO(2)e per kg of edible product, substantially smaller than most of the popular marine and terrestrial protein sources consumed in Sweden today. This could be even lower if cyprinid resources were better utilized than currently. The cyprinids however exhibited different vulnerability to fishing pressure and are today associated with data deficiencies. Hence, it is currently uncertain how much food for human consumption they can contribute to. Improved consumer interest and management attention is needed, but to the Swedish diet, cyprinids offer a promising opportunity for future more sustainable and nutritious food systems. |
format | Online Article Text |
id | pubmed-7007883 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-70078832020-02-24 Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food Hornborg, Sara Främberg, Anton Environ Manage Article The role of aquatic resources to food security is both promising and constrained since the global seafood consumption is increasing while marine fisheries approach the limit of what it can produce. In Sweden, the seafood consumption per capita is higher than the European and world average but the current dietary advice is to increase consumption. Freshwater fisheries have in general been paid less attention in food security discussions. Carp fishes (Cyprinidae) in Sweden have lost their historical value and are currently, both understudied and underutilized. Here we use a combined environmental assessment approach to examine the environmental sustainability of current and potential cyprinid fisheries. We found that current commercial fisheries for Swedish cyprinids in lakes have an average carbon footprint of 0.77 kg CO(2)e per kg of edible product, substantially smaller than most of the popular marine and terrestrial protein sources consumed in Sweden today. This could be even lower if cyprinid resources were better utilized than currently. The cyprinids however exhibited different vulnerability to fishing pressure and are today associated with data deficiencies. Hence, it is currently uncertain how much food for human consumption they can contribute to. Improved consumer interest and management attention is needed, but to the Swedish diet, cyprinids offer a promising opportunity for future more sustainable and nutritious food systems. Springer US 2019-12-19 2020 /pmc/articles/PMC7007883/ /pubmed/31858173 http://dx.doi.org/10.1007/s00267-019-01241-z Text en © The Author(s) 2020 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. |
spellingShingle | Article Hornborg, Sara Främberg, Anton Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title | Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title_full | Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title_fullStr | Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title_full_unstemmed | Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title_short | Carp (Cyprinidae) Fisheries in Swedish Lakes: A Combined Environmental Assessment Approach to Evaluate Data-limited Freshwater Fish Resources as Food |
title_sort | carp (cyprinidae) fisheries in swedish lakes: a combined environmental assessment approach to evaluate data-limited freshwater fish resources as food |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7007883/ https://www.ncbi.nlm.nih.gov/pubmed/31858173 http://dx.doi.org/10.1007/s00267-019-01241-z |
work_keys_str_mv | AT hornborgsara carpcyprinidaefisheriesinswedishlakesacombinedenvironmentalassessmentapproachtoevaluatedatalimitedfreshwaterfishresourcesasfood AT framberganton carpcyprinidaefisheriesinswedishlakesacombinedenvironmentalassessmentapproachtoevaluatedatalimitedfreshwaterfishresourcesasfood |