Cargando…
Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade
Hyperlipidemia is associated with metabolic disorders, but the detailed mechanisms and related interventions remain largely unclear. As a functional food in Asian diets, Herba houttuyniae has been reported to have beneficial effects on health. The present research was to investigate the protective e...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019422/ https://www.ncbi.nlm.nih.gov/pubmed/31936037 http://dx.doi.org/10.3390/nu12010164 |
_version_ | 1783497521472995328 |
---|---|
author | Cao, Ke Lv, Weiqiang Liu, Xuyun Fan, Yingying Wang, Kexin Feng, Zhihui Liu, Jianshu Zang, Weijin Xing, Lianxi Liu, Jiankang |
author_facet | Cao, Ke Lv, Weiqiang Liu, Xuyun Fan, Yingying Wang, Kexin Feng, Zhihui Liu, Jianshu Zang, Weijin Xing, Lianxi Liu, Jiankang |
author_sort | Cao, Ke |
collection | PubMed |
description | Hyperlipidemia is associated with metabolic disorders, but the detailed mechanisms and related interventions remain largely unclear. As a functional food in Asian diets, Herba houttuyniae has been reported to have beneficial effects on health. The present research was to investigate the protective effects of Herba houttuyniae aqueous extract (HAE) on hyperlipidemia-induced liver and heart impairments and its potential mechanisms. Male C57BL/6J mice were administered with 200 or 400 mg/kg/day HAE for 9 days, followed by intraperitoneal injection with 0.5 g/kg poloxamer 407 to induce acute hyperlipidemia. HAE treatment significantly attenuated excessive serum lipids and tissue damage markers, prevented hepatic lipid deposition, improved cardiac remodeling, and ameliorated hepatic and cardiac oxidative stress induced by hyperlipidemia. More importantly, NF-E2 related factor (Nrf2)-mediated antioxidant and peroxisome proliferator-activated receptor gamma coactivator-1 alpha (PGC-1α)-mediated mitochondrial biogenesis pathways as well as mitochondrial complex activities were downregulated in the hyperlipidemic mouse livers and hearts, which may be attributable to the loss of adenosine monophosphate (AMP)-activated protein kinase (AMPK) activity: all of these changes were reversed by HAE supplementation. Our findings link the AMPK/PGC-1α/Nrf2 cascade to hyperlipidemia-induced liver and heart impairments and demonstrate the protective effect of HAE as an AMPK activator in the prevention of hyperlipidemia-related diseases. |
format | Online Article Text |
id | pubmed-7019422 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-70194222020-03-09 Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade Cao, Ke Lv, Weiqiang Liu, Xuyun Fan, Yingying Wang, Kexin Feng, Zhihui Liu, Jianshu Zang, Weijin Xing, Lianxi Liu, Jiankang Nutrients Article Hyperlipidemia is associated with metabolic disorders, but the detailed mechanisms and related interventions remain largely unclear. As a functional food in Asian diets, Herba houttuyniae has been reported to have beneficial effects on health. The present research was to investigate the protective effects of Herba houttuyniae aqueous extract (HAE) on hyperlipidemia-induced liver and heart impairments and its potential mechanisms. Male C57BL/6J mice were administered with 200 or 400 mg/kg/day HAE for 9 days, followed by intraperitoneal injection with 0.5 g/kg poloxamer 407 to induce acute hyperlipidemia. HAE treatment significantly attenuated excessive serum lipids and tissue damage markers, prevented hepatic lipid deposition, improved cardiac remodeling, and ameliorated hepatic and cardiac oxidative stress induced by hyperlipidemia. More importantly, NF-E2 related factor (Nrf2)-mediated antioxidant and peroxisome proliferator-activated receptor gamma coactivator-1 alpha (PGC-1α)-mediated mitochondrial biogenesis pathways as well as mitochondrial complex activities were downregulated in the hyperlipidemic mouse livers and hearts, which may be attributable to the loss of adenosine monophosphate (AMP)-activated protein kinase (AMPK) activity: all of these changes were reversed by HAE supplementation. Our findings link the AMPK/PGC-1α/Nrf2 cascade to hyperlipidemia-induced liver and heart impairments and demonstrate the protective effect of HAE as an AMPK activator in the prevention of hyperlipidemia-related diseases. MDPI 2020-01-07 /pmc/articles/PMC7019422/ /pubmed/31936037 http://dx.doi.org/10.3390/nu12010164 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Cao, Ke Lv, Weiqiang Liu, Xuyun Fan, Yingying Wang, Kexin Feng, Zhihui Liu, Jianshu Zang, Weijin Xing, Lianxi Liu, Jiankang Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title | Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title_full | Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title_fullStr | Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title_full_unstemmed | Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title_short | Herba houttuyniae Extract Benefits Hyperlipidemic Mice via Activation of the AMPK/PGC-1α/Nrf2 Cascade |
title_sort | herba houttuyniae extract benefits hyperlipidemic mice via activation of the ampk/pgc-1α/nrf2 cascade |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019422/ https://www.ncbi.nlm.nih.gov/pubmed/31936037 http://dx.doi.org/10.3390/nu12010164 |
work_keys_str_mv | AT caoke herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT lvweiqiang herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT liuxuyun herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT fanyingying herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT wangkexin herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT fengzhihui herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT liujianshu herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT zangweijin herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT xinglianxi herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade AT liujiankang herbahouttuyniaeextractbenefitshyperlipidemicmiceviaactivationoftheampkpgc1anrf2cascade |