Cargando…
Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was t...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019581/ https://www.ncbi.nlm.nih.gov/pubmed/31936659 http://dx.doi.org/10.3390/jcm9010183 |
_version_ | 1783497552587390976 |
---|---|
author | Kosinska-Kaczynska, Katarzyna Zgliczynska, Magdalena Kozlowski, Szymon Wicherek, Lukasz |
author_facet | Kosinska-Kaczynska, Katarzyna Zgliczynska, Magdalena Kozlowski, Szymon Wicherek, Lukasz |
author_sort | Kosinska-Kaczynska, Katarzyna |
collection | PubMed |
description | Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was to summarize available data on maternal serum levels of the above-mentioned factors and their usefulness in predicting PE in twin pregnancies. Only original research articles written in English were considered eligible. Reviews, chapters, case studies, conference papers, experts’ opinions, editorials, and letters were excluded from the analysis. No publication date limitations were imposed. The systematic literature search using PubMed/MEDLINE, Scopus, Embase, and Cochrane Library databases identified 338 articles, 10 of which were included in the final qualitative analyses. The included studies showed significant differences in maternal serum levels of the discussed factors between women with twin pregnancies with PE and those who did not develop PE, and their promising performance in predicting PE, alone or in combination with other factors. The identification of the most effective algorithms, their prompt introduction to the clinical practice, and further assessment of the real-life performance should become a priority. |
format | Online Article Text |
id | pubmed-7019581 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-70195812020-03-09 Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review Kosinska-Kaczynska, Katarzyna Zgliczynska, Magdalena Kozlowski, Szymon Wicherek, Lukasz J Clin Med Review Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was to summarize available data on maternal serum levels of the above-mentioned factors and their usefulness in predicting PE in twin pregnancies. Only original research articles written in English were considered eligible. Reviews, chapters, case studies, conference papers, experts’ opinions, editorials, and letters were excluded from the analysis. No publication date limitations were imposed. The systematic literature search using PubMed/MEDLINE, Scopus, Embase, and Cochrane Library databases identified 338 articles, 10 of which were included in the final qualitative analyses. The included studies showed significant differences in maternal serum levels of the discussed factors between women with twin pregnancies with PE and those who did not develop PE, and their promising performance in predicting PE, alone or in combination with other factors. The identification of the most effective algorithms, their prompt introduction to the clinical practice, and further assessment of the real-life performance should become a priority. MDPI 2020-01-09 /pmc/articles/PMC7019581/ /pubmed/31936659 http://dx.doi.org/10.3390/jcm9010183 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Kosinska-Kaczynska, Katarzyna Zgliczynska, Magdalena Kozlowski, Szymon Wicherek, Lukasz Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title | Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title_full | Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title_fullStr | Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title_full_unstemmed | Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title_short | Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review |
title_sort | maternal serum placental growth factor, soluble fms-like tyrosine kinase-1, and soluble endoglin in twin gestations and the risk of preeclampsia—a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019581/ https://www.ncbi.nlm.nih.gov/pubmed/31936659 http://dx.doi.org/10.3390/jcm9010183 |
work_keys_str_mv | AT kosinskakaczynskakatarzyna maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview AT zgliczynskamagdalena maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview AT kozlowskiszymon maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview AT wichereklukasz maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview |