Cargando…

Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review

Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was t...

Descripción completa

Detalles Bibliográficos
Autores principales: Kosinska-Kaczynska, Katarzyna, Zgliczynska, Magdalena, Kozlowski, Szymon, Wicherek, Lukasz
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019581/
https://www.ncbi.nlm.nih.gov/pubmed/31936659
http://dx.doi.org/10.3390/jcm9010183
_version_ 1783497552587390976
author Kosinska-Kaczynska, Katarzyna
Zgliczynska, Magdalena
Kozlowski, Szymon
Wicherek, Lukasz
author_facet Kosinska-Kaczynska, Katarzyna
Zgliczynska, Magdalena
Kozlowski, Szymon
Wicherek, Lukasz
author_sort Kosinska-Kaczynska, Katarzyna
collection PubMed
description Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was to summarize available data on maternal serum levels of the above-mentioned factors and their usefulness in predicting PE in twin pregnancies. Only original research articles written in English were considered eligible. Reviews, chapters, case studies, conference papers, experts’ opinions, editorials, and letters were excluded from the analysis. No publication date limitations were imposed. The systematic literature search using PubMed/MEDLINE, Scopus, Embase, and Cochrane Library databases identified 338 articles, 10 of which were included in the final qualitative analyses. The included studies showed significant differences in maternal serum levels of the discussed factors between women with twin pregnancies with PE and those who did not develop PE, and their promising performance in predicting PE, alone or in combination with other factors. The identification of the most effective algorithms, their prompt introduction to the clinical practice, and further assessment of the real-life performance should become a priority.
format Online
Article
Text
id pubmed-7019581
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-70195812020-03-09 Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review Kosinska-Kaczynska, Katarzyna Zgliczynska, Magdalena Kozlowski, Szymon Wicherek, Lukasz J Clin Med Review Multiple gestation is one of the key risk factors for the occurrence of preeclampsia (PE). Soluble fms-like tyrosine kinase-1, placental growth factor, and soluble endoglin are molecules involved in the process of angiogenesis with a proven role in the pathogenesis of PE. The aim of the review was to summarize available data on maternal serum levels of the above-mentioned factors and their usefulness in predicting PE in twin pregnancies. Only original research articles written in English were considered eligible. Reviews, chapters, case studies, conference papers, experts’ opinions, editorials, and letters were excluded from the analysis. No publication date limitations were imposed. The systematic literature search using PubMed/MEDLINE, Scopus, Embase, and Cochrane Library databases identified 338 articles, 10 of which were included in the final qualitative analyses. The included studies showed significant differences in maternal serum levels of the discussed factors between women with twin pregnancies with PE and those who did not develop PE, and their promising performance in predicting PE, alone or in combination with other factors. The identification of the most effective algorithms, their prompt introduction to the clinical practice, and further assessment of the real-life performance should become a priority. MDPI 2020-01-09 /pmc/articles/PMC7019581/ /pubmed/31936659 http://dx.doi.org/10.3390/jcm9010183 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Kosinska-Kaczynska, Katarzyna
Zgliczynska, Magdalena
Kozlowski, Szymon
Wicherek, Lukasz
Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title_full Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title_fullStr Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title_full_unstemmed Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title_short Maternal Serum Placental Growth Factor, Soluble Fms-Like Tyrosine Kinase-1, and Soluble Endoglin in Twin Gestations and the Risk of Preeclampsia—A Systematic Review
title_sort maternal serum placental growth factor, soluble fms-like tyrosine kinase-1, and soluble endoglin in twin gestations and the risk of preeclampsia—a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7019581/
https://www.ncbi.nlm.nih.gov/pubmed/31936659
http://dx.doi.org/10.3390/jcm9010183
work_keys_str_mv AT kosinskakaczynskakatarzyna maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview
AT zgliczynskamagdalena maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview
AT kozlowskiszymon maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview
AT wichereklukasz maternalserumplacentalgrowthfactorsolublefmsliketyrosinekinase1andsolubleendoglinintwingestationsandtheriskofpreeclampsiaasystematicreview