Cargando…
MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7027243/ https://www.ncbi.nlm.nih.gov/pubmed/32066367 http://dx.doi.org/10.1186/s12864-020-6570-8 |
_version_ | 1783498830989230080 |
---|---|
author | Xu, Hua Wang, Xin Wang, Zhikai Li, Jianhui Xu, Zhiming Miao, Maohua Chen, Guowu Lei, Xiangdong Wu, Jun Shi, Huijuan Wang, Ke Zhang, Tiancheng Sun, Xiaoxi |
author_facet | Xu, Hua Wang, Xin Wang, Zhikai Li, Jianhui Xu, Zhiming Miao, Maohua Chen, Guowu Lei, Xiangdong Wu, Jun Shi, Huijuan Wang, Ke Zhang, Tiancheng Sun, Xiaoxi |
author_sort | Xu, Hua |
collection | PubMed |
description | BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the regulatory network in development progression. However, few studies have focused on the effects of miRNAs on early human embryonic development. The relationship between miRNAs and early human embryogenesis is still unknown. RESULTS: In this study, RNA-seq data collected from sperm samples from 102 patients with a normal sperm index but treated with assisted reproductive technology (ART) were analyzed for the relationships between differentially expressed small RNAs and the fertilization rate (FR), blastocyst rate and high-quality embryo rate (HQER). The sperm samples with high hsa-mir-191 expression had a higher FR, effective embryo rate (EER) and HQER. hsa-mir-191 was used as a single indicator to predict the HQER. The receiver operating characteristic (ROC) curve had an area under the ROC curve (AUC) of 0.686. We also found that hsa-mir-191 expression is correlated with an abnormal sperm rate (cor = 0.29, p < 0.01). We also evaluated the relationship between hsa-mir-34c and early human embryo development in these 102 sperm samples and obtained negative results. CONCLUSIONS: These findings suggest that high hsa-mir-191-5p expression in sperm is associated with early human embryonic quality and that hsa-mir-191-5p could be used as a potential marker to screen high-quality sperm to improve the success rates of in vitro fertilization (IVF). |
format | Online Article Text |
id | pubmed-7027243 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-70272432020-02-24 MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization Xu, Hua Wang, Xin Wang, Zhikai Li, Jianhui Xu, Zhiming Miao, Maohua Chen, Guowu Lei, Xiangdong Wu, Jun Shi, Huijuan Wang, Ke Zhang, Tiancheng Sun, Xiaoxi BMC Genomics Research Article BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the regulatory network in development progression. However, few studies have focused on the effects of miRNAs on early human embryonic development. The relationship between miRNAs and early human embryogenesis is still unknown. RESULTS: In this study, RNA-seq data collected from sperm samples from 102 patients with a normal sperm index but treated with assisted reproductive technology (ART) were analyzed for the relationships between differentially expressed small RNAs and the fertilization rate (FR), blastocyst rate and high-quality embryo rate (HQER). The sperm samples with high hsa-mir-191 expression had a higher FR, effective embryo rate (EER) and HQER. hsa-mir-191 was used as a single indicator to predict the HQER. The receiver operating characteristic (ROC) curve had an area under the ROC curve (AUC) of 0.686. We also found that hsa-mir-191 expression is correlated with an abnormal sperm rate (cor = 0.29, p < 0.01). We also evaluated the relationship between hsa-mir-34c and early human embryo development in these 102 sperm samples and obtained negative results. CONCLUSIONS: These findings suggest that high hsa-mir-191-5p expression in sperm is associated with early human embryonic quality and that hsa-mir-191-5p could be used as a potential marker to screen high-quality sperm to improve the success rates of in vitro fertilization (IVF). BioMed Central 2020-02-17 /pmc/articles/PMC7027243/ /pubmed/32066367 http://dx.doi.org/10.1186/s12864-020-6570-8 Text en © The Author(s). 2020 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Xu, Hua Wang, Xin Wang, Zhikai Li, Jianhui Xu, Zhiming Miao, Maohua Chen, Guowu Lei, Xiangdong Wu, Jun Shi, Huijuan Wang, Ke Zhang, Tiancheng Sun, Xiaoxi MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title | MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title_full | MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title_fullStr | MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title_full_unstemmed | MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title_short | MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
title_sort | microrna expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7027243/ https://www.ncbi.nlm.nih.gov/pubmed/32066367 http://dx.doi.org/10.1186/s12864-020-6570-8 |
work_keys_str_mv | AT xuhua micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT wangxin micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT wangzhikai micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT lijianhui micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT xuzhiming micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT miaomaohua micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT chenguowu micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT leixiangdong micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT wujun micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT shihuijuan micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT wangke micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT zhangtiancheng micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization AT sunxiaoxi micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization |