Cargando…

MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization

BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the...

Descripción completa

Detalles Bibliográficos
Autores principales: Xu, Hua, Wang, Xin, Wang, Zhikai, Li, Jianhui, Xu, Zhiming, Miao, Maohua, Chen, Guowu, Lei, Xiangdong, Wu, Jun, Shi, Huijuan, Wang, Ke, Zhang, Tiancheng, Sun, Xiaoxi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7027243/
https://www.ncbi.nlm.nih.gov/pubmed/32066367
http://dx.doi.org/10.1186/s12864-020-6570-8
_version_ 1783498830989230080
author Xu, Hua
Wang, Xin
Wang, Zhikai
Li, Jianhui
Xu, Zhiming
Miao, Maohua
Chen, Guowu
Lei, Xiangdong
Wu, Jun
Shi, Huijuan
Wang, Ke
Zhang, Tiancheng
Sun, Xiaoxi
author_facet Xu, Hua
Wang, Xin
Wang, Zhikai
Li, Jianhui
Xu, Zhiming
Miao, Maohua
Chen, Guowu
Lei, Xiangdong
Wu, Jun
Shi, Huijuan
Wang, Ke
Zhang, Tiancheng
Sun, Xiaoxi
author_sort Xu, Hua
collection PubMed
description BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the regulatory network in development progression. However, few studies have focused on the effects of miRNAs on early human embryonic development. The relationship between miRNAs and early human embryogenesis is still unknown. RESULTS: In this study, RNA-seq data collected from sperm samples from 102 patients with a normal sperm index but treated with assisted reproductive technology (ART) were analyzed for the relationships between differentially expressed small RNAs and the fertilization rate (FR), blastocyst rate and high-quality embryo rate (HQER). The sperm samples with high hsa-mir-191 expression had a higher FR, effective embryo rate (EER) and HQER. hsa-mir-191 was used as a single indicator to predict the HQER. The receiver operating characteristic (ROC) curve had an area under the ROC curve (AUC) of 0.686. We also found that hsa-mir-191 expression is correlated with an abnormal sperm rate (cor = 0.29, p < 0.01). We also evaluated the relationship between hsa-mir-34c and early human embryo development in these 102 sperm samples and obtained negative results. CONCLUSIONS: These findings suggest that high hsa-mir-191-5p expression in sperm is associated with early human embryonic quality and that hsa-mir-191-5p could be used as a potential marker to screen high-quality sperm to improve the success rates of in vitro fertilization (IVF).
format Online
Article
Text
id pubmed-7027243
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-70272432020-02-24 MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization Xu, Hua Wang, Xin Wang, Zhikai Li, Jianhui Xu, Zhiming Miao, Maohua Chen, Guowu Lei, Xiangdong Wu, Jun Shi, Huijuan Wang, Ke Zhang, Tiancheng Sun, Xiaoxi BMC Genomics Research Article BACKGROUND: MicroRNAs (miRNAs) are a class of noncoding small RNAs that play important roles in many physiological processes by regulating gene expression. Previous studies have shown that the expression levels of total miRNAs increase during mouse embryonic development, and some miRNAs control the regulatory network in development progression. However, few studies have focused on the effects of miRNAs on early human embryonic development. The relationship between miRNAs and early human embryogenesis is still unknown. RESULTS: In this study, RNA-seq data collected from sperm samples from 102 patients with a normal sperm index but treated with assisted reproductive technology (ART) were analyzed for the relationships between differentially expressed small RNAs and the fertilization rate (FR), blastocyst rate and high-quality embryo rate (HQER). The sperm samples with high hsa-mir-191 expression had a higher FR, effective embryo rate (EER) and HQER. hsa-mir-191 was used as a single indicator to predict the HQER. The receiver operating characteristic (ROC) curve had an area under the ROC curve (AUC) of 0.686. We also found that hsa-mir-191 expression is correlated with an abnormal sperm rate (cor = 0.29, p < 0.01). We also evaluated the relationship between hsa-mir-34c and early human embryo development in these 102 sperm samples and obtained negative results. CONCLUSIONS: These findings suggest that high hsa-mir-191-5p expression in sperm is associated with early human embryonic quality and that hsa-mir-191-5p could be used as a potential marker to screen high-quality sperm to improve the success rates of in vitro fertilization (IVF). BioMed Central 2020-02-17 /pmc/articles/PMC7027243/ /pubmed/32066367 http://dx.doi.org/10.1186/s12864-020-6570-8 Text en © The Author(s). 2020 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Xu, Hua
Wang, Xin
Wang, Zhikai
Li, Jianhui
Xu, Zhiming
Miao, Maohua
Chen, Guowu
Lei, Xiangdong
Wu, Jun
Shi, Huijuan
Wang, Ke
Zhang, Tiancheng
Sun, Xiaoxi
MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title_full MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title_fullStr MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title_full_unstemmed MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title_short MicroRNA expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
title_sort microrna expression profile analysis in sperm reveals hsa-mir-191 as an auspicious omen of in vitro fertilization
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7027243/
https://www.ncbi.nlm.nih.gov/pubmed/32066367
http://dx.doi.org/10.1186/s12864-020-6570-8
work_keys_str_mv AT xuhua micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT wangxin micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT wangzhikai micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT lijianhui micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT xuzhiming micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT miaomaohua micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT chenguowu micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT leixiangdong micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT wujun micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT shihuijuan micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT wangke micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT zhangtiancheng micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization
AT sunxiaoxi micrornaexpressionprofileanalysisinspermrevealshsamir191asanauspiciousomenofinvitrofertilization