Cargando…

Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain

Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, gl...

Descripción completa

Detalles Bibliográficos
Autores principales: Furube, Eriko, Ishii, Haruna, Nambu, Yuri, Kurganov, Erkin, Nagaoka, Sumiharu, Morita, Mitsuhiro, Miyata, Seiji
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7029029/
https://www.ncbi.nlm.nih.gov/pubmed/32071335
http://dx.doi.org/10.1038/s41598-020-59629-5
_version_ 1783499085453459456
author Furube, Eriko
Ishii, Haruna
Nambu, Yuri
Kurganov, Erkin
Nagaoka, Sumiharu
Morita, Mitsuhiro
Miyata, Seiji
author_facet Furube, Eriko
Ishii, Haruna
Nambu, Yuri
Kurganov, Erkin
Nagaoka, Sumiharu
Morita, Mitsuhiro
Miyata, Seiji
author_sort Furube, Eriko
collection PubMed
description Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, glial fibrillar acidic protein and sex determining region Y. Proliferation of these tanycyte-like ependymal cells was promoted by continuous intracerebroventricular infusion of fibroblast growth factor-2 and epidermal growth factor. Tanycytes-like ependymal cells in the CC are able to form self-renewing neurospheres and give rise mostly to new astrocytes and oligodendrocytes. Collagenase-induced small medullary hemorrhage increased proliferation of tanycyte-like ependymal cells in the CC. These results demonstrate that these tanycyte-like ependymal cells of the adult mouse brain are NSCs and suggest that they serve as a source for providing new neuronal lineage cells upon brain damage in the medulla oblongata.
format Online
Article
Text
id pubmed-7029029
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-70290292020-02-26 Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain Furube, Eriko Ishii, Haruna Nambu, Yuri Kurganov, Erkin Nagaoka, Sumiharu Morita, Mitsuhiro Miyata, Seiji Sci Rep Article Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, glial fibrillar acidic protein and sex determining region Y. Proliferation of these tanycyte-like ependymal cells was promoted by continuous intracerebroventricular infusion of fibroblast growth factor-2 and epidermal growth factor. Tanycytes-like ependymal cells in the CC are able to form self-renewing neurospheres and give rise mostly to new astrocytes and oligodendrocytes. Collagenase-induced small medullary hemorrhage increased proliferation of tanycyte-like ependymal cells in the CC. These results demonstrate that these tanycyte-like ependymal cells of the adult mouse brain are NSCs and suggest that they serve as a source for providing new neuronal lineage cells upon brain damage in the medulla oblongata. Nature Publishing Group UK 2020-02-18 /pmc/articles/PMC7029029/ /pubmed/32071335 http://dx.doi.org/10.1038/s41598-020-59629-5 Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Furube, Eriko
Ishii, Haruna
Nambu, Yuri
Kurganov, Erkin
Nagaoka, Sumiharu
Morita, Mitsuhiro
Miyata, Seiji
Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title_full Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title_fullStr Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title_full_unstemmed Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title_short Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
title_sort neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7029029/
https://www.ncbi.nlm.nih.gov/pubmed/32071335
http://dx.doi.org/10.1038/s41598-020-59629-5
work_keys_str_mv AT furubeeriko neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT ishiiharuna neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT nambuyuri neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT kurganoverkin neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT nagaokasumiharu neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT moritamitsuhiro neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain
AT miyataseiji neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain