Cargando…
Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain
Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, gl...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7029029/ https://www.ncbi.nlm.nih.gov/pubmed/32071335 http://dx.doi.org/10.1038/s41598-020-59629-5 |
_version_ | 1783499085453459456 |
---|---|
author | Furube, Eriko Ishii, Haruna Nambu, Yuri Kurganov, Erkin Nagaoka, Sumiharu Morita, Mitsuhiro Miyata, Seiji |
author_facet | Furube, Eriko Ishii, Haruna Nambu, Yuri Kurganov, Erkin Nagaoka, Sumiharu Morita, Mitsuhiro Miyata, Seiji |
author_sort | Furube, Eriko |
collection | PubMed |
description | Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, glial fibrillar acidic protein and sex determining region Y. Proliferation of these tanycyte-like ependymal cells was promoted by continuous intracerebroventricular infusion of fibroblast growth factor-2 and epidermal growth factor. Tanycytes-like ependymal cells in the CC are able to form self-renewing neurospheres and give rise mostly to new astrocytes and oligodendrocytes. Collagenase-induced small medullary hemorrhage increased proliferation of tanycyte-like ependymal cells in the CC. These results demonstrate that these tanycyte-like ependymal cells of the adult mouse brain are NSCs and suggest that they serve as a source for providing new neuronal lineage cells upon brain damage in the medulla oblongata. |
format | Online Article Text |
id | pubmed-7029029 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-70290292020-02-26 Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain Furube, Eriko Ishii, Haruna Nambu, Yuri Kurganov, Erkin Nagaoka, Sumiharu Morita, Mitsuhiro Miyata, Seiji Sci Rep Article Tanycyte is a subtype of ependymal cells which extend long radial processes to brain parenchyma. The present study showed that tanycyte-like ependymal cells in the organum vasculosum of the lamina terminalis, subfornical organ and central canal (CC) expressed neural stem cell (NSC) marker nestin, glial fibrillar acidic protein and sex determining region Y. Proliferation of these tanycyte-like ependymal cells was promoted by continuous intracerebroventricular infusion of fibroblast growth factor-2 and epidermal growth factor. Tanycytes-like ependymal cells in the CC are able to form self-renewing neurospheres and give rise mostly to new astrocytes and oligodendrocytes. Collagenase-induced small medullary hemorrhage increased proliferation of tanycyte-like ependymal cells in the CC. These results demonstrate that these tanycyte-like ependymal cells of the adult mouse brain are NSCs and suggest that they serve as a source for providing new neuronal lineage cells upon brain damage in the medulla oblongata. Nature Publishing Group UK 2020-02-18 /pmc/articles/PMC7029029/ /pubmed/32071335 http://dx.doi.org/10.1038/s41598-020-59629-5 Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Furube, Eriko Ishii, Haruna Nambu, Yuri Kurganov, Erkin Nagaoka, Sumiharu Morita, Mitsuhiro Miyata, Seiji Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title | Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title_full | Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title_fullStr | Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title_full_unstemmed | Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title_short | Neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
title_sort | neural stem cell phenotype of tanycyte-like ependymal cells in the circumventricular organs and central canal of adult mouse brain |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7029029/ https://www.ncbi.nlm.nih.gov/pubmed/32071335 http://dx.doi.org/10.1038/s41598-020-59629-5 |
work_keys_str_mv | AT furubeeriko neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT ishiiharuna neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT nambuyuri neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT kurganoverkin neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT nagaokasumiharu neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT moritamitsuhiro neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain AT miyataseiji neuralstemcellphenotypeoftanycytelikeependymalcellsinthecircumventricularorgansandcentralcanalofadultmousebrain |