Cargando…

Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients

BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male pa...

Descripción completa

Detalles Bibliográficos
Autor principal: Al-Hazmi, Ayman S
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Makerere Medical School 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7040324/
https://www.ncbi.nlm.nih.gov/pubmed/32127856
http://dx.doi.org/10.4314/ahs.v19i4.2
_version_ 1783500962931933184
author Al-Hazmi, Ayman S
author_facet Al-Hazmi, Ayman S
author_sort Al-Hazmi, Ayman S
collection PubMed
description BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male patients were included in this study and one hundred healthy Saudi men were used as control. For each individual, fasting blood glucose, cholesterol, HDL-C, LDL-C, HbA1c, insulin and 25-(OH) vitamin D were measured. In addition, Apal, BsmI and TaqI genotypes were performed for each subject. Data was analyzed by SPSS version 16, using Spearman's rho and ANOVA tests. RESULTS: There was significant inverse correlation between 25-(OH) vitamin D level and T2DM (p<0.01). HbA1c was inversely correlated with 25-(OH) vitamin D level (P<0.05). Genotype study showed that tt of TaqI genotype was higher in T2DM group compared with control group (p<0.05). Moreover, tt genotype has higher HbA1c than both TT and Tt genotypes (p<0.05). CONCLUSION: An association was confirmed between TaqI genotypes and T2DM but there is no correlation between BsmI, ApaI and T2DM. In addition, HbA1c is positively correlated with tt genotype of TaqI.
format Online
Article
Text
id pubmed-7040324
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Makerere Medical School
record_format MEDLINE/PubMed
spelling pubmed-70403242020-03-03 Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients Al-Hazmi, Ayman S Afr Health Sci Articles BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male patients were included in this study and one hundred healthy Saudi men were used as control. For each individual, fasting blood glucose, cholesterol, HDL-C, LDL-C, HbA1c, insulin and 25-(OH) vitamin D were measured. In addition, Apal, BsmI and TaqI genotypes were performed for each subject. Data was analyzed by SPSS version 16, using Spearman's rho and ANOVA tests. RESULTS: There was significant inverse correlation between 25-(OH) vitamin D level and T2DM (p<0.01). HbA1c was inversely correlated with 25-(OH) vitamin D level (P<0.05). Genotype study showed that tt of TaqI genotype was higher in T2DM group compared with control group (p<0.05). Moreover, tt genotype has higher HbA1c than both TT and Tt genotypes (p<0.05). CONCLUSION: An association was confirmed between TaqI genotypes and T2DM but there is no correlation between BsmI, ApaI and T2DM. In addition, HbA1c is positively correlated with tt genotype of TaqI. Makerere Medical School 2019-12 /pmc/articles/PMC7040324/ /pubmed/32127856 http://dx.doi.org/10.4314/ahs.v19i4.2 Text en © 2019 Al-Hazmi AS. Licensee African Health Sciences. This is an Open Access article distributed under the terms of the Creative commons Attribution License (https://creativecommons.org/licenses/BY/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Articles
Al-Hazmi, Ayman S
Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title_full Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title_fullStr Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title_full_unstemmed Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title_short Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
title_sort association of vitamin d deficiency and vitamin d receptor gene polymorphisms with type 2 diabetes mellitus saudi patients
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7040324/
https://www.ncbi.nlm.nih.gov/pubmed/32127856
http://dx.doi.org/10.4314/ahs.v19i4.2
work_keys_str_mv AT alhazmiaymans associationofvitaminddeficiencyandvitamindreceptorgenepolymorphismswithtype2diabetesmellitussaudipatients