Cargando…
Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients
BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male pa...
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Makerere Medical School
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7040324/ https://www.ncbi.nlm.nih.gov/pubmed/32127856 http://dx.doi.org/10.4314/ahs.v19i4.2 |
_version_ | 1783500962931933184 |
---|---|
author | Al-Hazmi, Ayman S |
author_facet | Al-Hazmi, Ayman S |
author_sort | Al-Hazmi, Ayman S |
collection | PubMed |
description | BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male patients were included in this study and one hundred healthy Saudi men were used as control. For each individual, fasting blood glucose, cholesterol, HDL-C, LDL-C, HbA1c, insulin and 25-(OH) vitamin D were measured. In addition, Apal, BsmI and TaqI genotypes were performed for each subject. Data was analyzed by SPSS version 16, using Spearman's rho and ANOVA tests. RESULTS: There was significant inverse correlation between 25-(OH) vitamin D level and T2DM (p<0.01). HbA1c was inversely correlated with 25-(OH) vitamin D level (P<0.05). Genotype study showed that tt of TaqI genotype was higher in T2DM group compared with control group (p<0.05). Moreover, tt genotype has higher HbA1c than both TT and Tt genotypes (p<0.05). CONCLUSION: An association was confirmed between TaqI genotypes and T2DM but there is no correlation between BsmI, ApaI and T2DM. In addition, HbA1c is positively correlated with tt genotype of TaqI. |
format | Online Article Text |
id | pubmed-7040324 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Makerere Medical School |
record_format | MEDLINE/PubMed |
spelling | pubmed-70403242020-03-03 Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients Al-Hazmi, Ayman S Afr Health Sci Articles BACKGROUND: Type 2 diabetes mellitus (T2DM) is a global problem. Association of multiple genes in T2DM becomes a hot point recently. This study was aimed to evaluate association of vitamin D receptor gene polymorphisms with susceptibility to T2DM. SUBJECTS AND METHODS: One hundred T2DM Saudi male patients were included in this study and one hundred healthy Saudi men were used as control. For each individual, fasting blood glucose, cholesterol, HDL-C, LDL-C, HbA1c, insulin and 25-(OH) vitamin D were measured. In addition, Apal, BsmI and TaqI genotypes were performed for each subject. Data was analyzed by SPSS version 16, using Spearman's rho and ANOVA tests. RESULTS: There was significant inverse correlation between 25-(OH) vitamin D level and T2DM (p<0.01). HbA1c was inversely correlated with 25-(OH) vitamin D level (P<0.05). Genotype study showed that tt of TaqI genotype was higher in T2DM group compared with control group (p<0.05). Moreover, tt genotype has higher HbA1c than both TT and Tt genotypes (p<0.05). CONCLUSION: An association was confirmed between TaqI genotypes and T2DM but there is no correlation between BsmI, ApaI and T2DM. In addition, HbA1c is positively correlated with tt genotype of TaqI. Makerere Medical School 2019-12 /pmc/articles/PMC7040324/ /pubmed/32127856 http://dx.doi.org/10.4314/ahs.v19i4.2 Text en © 2019 Al-Hazmi AS. Licensee African Health Sciences. This is an Open Access article distributed under the terms of the Creative commons Attribution License (https://creativecommons.org/licenses/BY/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Articles Al-Hazmi, Ayman S Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title | Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title_full | Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title_fullStr | Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title_full_unstemmed | Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title_short | Association of Vitamin D deficiency and Vitamin D Receptor Gene Polymorphisms with Type 2 diabetes mellitus Saudi patients |
title_sort | association of vitamin d deficiency and vitamin d receptor gene polymorphisms with type 2 diabetes mellitus saudi patients |
topic | Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7040324/ https://www.ncbi.nlm.nih.gov/pubmed/32127856 http://dx.doi.org/10.4314/ahs.v19i4.2 |
work_keys_str_mv | AT alhazmiaymans associationofvitaminddeficiencyandvitamindreceptorgenepolymorphismswithtype2diabetesmellitussaudipatients |