Cargando…
Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains l...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7046476/ https://www.ncbi.nlm.nih.gov/pubmed/31837068 http://dx.doi.org/10.1111/cpr.12741 |
_version_ | 1783501953327693824 |
---|---|
author | Liu, Yu Qi, Jian Dou, Zhen Hu, Jiliang Lu, Li Dai, Haiming Wang, Hongzhi Yang, Wulin |
author_facet | Liu, Yu Qi, Jian Dou, Zhen Hu, Jiliang Lu, Li Dai, Haiming Wang, Hongzhi Yang, Wulin |
author_sort | Liu, Yu |
collection | PubMed |
description | OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains largely unclear. MATERIALS AND METHODS: In this study, we used a set of bioinformatic tools to jointly analyse the expression of WEE family kinases and investigate the prognostic value of PKMYT1 in breast cancer. RESULTS: The results indicated that PKMYT1 is the only frequently overexpressed member of WEE family kinases in breast cancer. KM plotter data suggests that abnormally high expression of PKMYT1 predicts poor prognosis, especially for some subtypes, such as luminal A/B and triple‐negative (TNBC) types. Moreover, the up‐regulation of PKMYT1 was associated with HER2‐positive (HER2+), basal‐like (Basal‐like), TNBC statuses and increased classifications of Scarff, Bloom and Richardson (SBR). Co‐expression analysis showed PKMYT1 has a strong positive correlation with Polo‐like kinase 1 (PLK1), implying they may cooperate in regulating cancer cell proliferation by synchronizing rapid cell cycle with high quality of genome maintenance. CONCLUSIONS: Collectively, this study demonstrates that overexpression of PKMYT1 is always found in breast cancer and predicts unfavourable prognosis, implicating it as an appealing therapeutic target for breast carcinoma. |
format | Online Article Text |
id | pubmed-7046476 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-70464762020-03-13 Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis Liu, Yu Qi, Jian Dou, Zhen Hu, Jiliang Lu, Li Dai, Haiming Wang, Hongzhi Yang, Wulin Cell Prolif Original Articles OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains largely unclear. MATERIALS AND METHODS: In this study, we used a set of bioinformatic tools to jointly analyse the expression of WEE family kinases and investigate the prognostic value of PKMYT1 in breast cancer. RESULTS: The results indicated that PKMYT1 is the only frequently overexpressed member of WEE family kinases in breast cancer. KM plotter data suggests that abnormally high expression of PKMYT1 predicts poor prognosis, especially for some subtypes, such as luminal A/B and triple‐negative (TNBC) types. Moreover, the up‐regulation of PKMYT1 was associated with HER2‐positive (HER2+), basal‐like (Basal‐like), TNBC statuses and increased classifications of Scarff, Bloom and Richardson (SBR). Co‐expression analysis showed PKMYT1 has a strong positive correlation with Polo‐like kinase 1 (PLK1), implying they may cooperate in regulating cancer cell proliferation by synchronizing rapid cell cycle with high quality of genome maintenance. CONCLUSIONS: Collectively, this study demonstrates that overexpression of PKMYT1 is always found in breast cancer and predicts unfavourable prognosis, implicating it as an appealing therapeutic target for breast carcinoma. John Wiley and Sons Inc. 2019-12-14 /pmc/articles/PMC7046476/ /pubmed/31837068 http://dx.doi.org/10.1111/cpr.12741 Text en © 2019 The Authors. Cell Proliferation Published by John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Articles Liu, Yu Qi, Jian Dou, Zhen Hu, Jiliang Lu, Li Dai, Haiming Wang, Hongzhi Yang, Wulin Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title | Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title_full | Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title_fullStr | Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title_full_unstemmed | Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title_short | Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis |
title_sort | systematic expression analysis of wee family kinases reveals the importance of pkmyt1 in breast carcinogenesis |
topic | Original Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7046476/ https://www.ncbi.nlm.nih.gov/pubmed/31837068 http://dx.doi.org/10.1111/cpr.12741 |
work_keys_str_mv | AT liuyu systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT qijian systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT douzhen systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT hujiliang systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT luli systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT daihaiming systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT wanghongzhi systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis AT yangwulin systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis |