Cargando…

Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis

OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains l...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Yu, Qi, Jian, Dou, Zhen, Hu, Jiliang, Lu, Li, Dai, Haiming, Wang, Hongzhi, Yang, Wulin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7046476/
https://www.ncbi.nlm.nih.gov/pubmed/31837068
http://dx.doi.org/10.1111/cpr.12741
_version_ 1783501953327693824
author Liu, Yu
Qi, Jian
Dou, Zhen
Hu, Jiliang
Lu, Li
Dai, Haiming
Wang, Hongzhi
Yang, Wulin
author_facet Liu, Yu
Qi, Jian
Dou, Zhen
Hu, Jiliang
Lu, Li
Dai, Haiming
Wang, Hongzhi
Yang, Wulin
author_sort Liu, Yu
collection PubMed
description OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains largely unclear. MATERIALS AND METHODS: In this study, we used a set of bioinformatic tools to jointly analyse the expression of WEE family kinases and investigate the prognostic value of PKMYT1 in breast cancer. RESULTS: The results indicated that PKMYT1 is the only frequently overexpressed member of WEE family kinases in breast cancer. KM plotter data suggests that abnormally high expression of PKMYT1 predicts poor prognosis, especially for some subtypes, such as luminal A/B and triple‐negative (TNBC) types. Moreover, the up‐regulation of PKMYT1 was associated with HER2‐positive (HER2+), basal‐like (Basal‐like), TNBC statuses and increased classifications of Scarff, Bloom and Richardson (SBR). Co‐expression analysis showed PKMYT1 has a strong positive correlation with Polo‐like kinase 1 (PLK1), implying they may cooperate in regulating cancer cell proliferation by synchronizing rapid cell cycle with high quality of genome maintenance. CONCLUSIONS: Collectively, this study demonstrates that overexpression of PKMYT1 is always found in breast cancer and predicts unfavourable prognosis, implicating it as an appealing therapeutic target for breast carcinoma.
format Online
Article
Text
id pubmed-7046476
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-70464762020-03-13 Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis Liu, Yu Qi, Jian Dou, Zhen Hu, Jiliang Lu, Li Dai, Haiming Wang, Hongzhi Yang, Wulin Cell Prolif Original Articles OBJECTIVES: Many cancer cells depend on G2 checkpoint mechanism regulated by WEE family kinases to maintain genomic integrity. The PKMYT1 gene, as a member of WEE family kinases, participates in G2 checkpoint surveillance and probably links with tumorigenesis, but its role in breast cancer remains largely unclear. MATERIALS AND METHODS: In this study, we used a set of bioinformatic tools to jointly analyse the expression of WEE family kinases and investigate the prognostic value of PKMYT1 in breast cancer. RESULTS: The results indicated that PKMYT1 is the only frequently overexpressed member of WEE family kinases in breast cancer. KM plotter data suggests that abnormally high expression of PKMYT1 predicts poor prognosis, especially for some subtypes, such as luminal A/B and triple‐negative (TNBC) types. Moreover, the up‐regulation of PKMYT1 was associated with HER2‐positive (HER2+), basal‐like (Basal‐like), TNBC statuses and increased classifications of Scarff, Bloom and Richardson (SBR). Co‐expression analysis showed PKMYT1 has a strong positive correlation with Polo‐like kinase 1 (PLK1), implying they may cooperate in regulating cancer cell proliferation by synchronizing rapid cell cycle with high quality of genome maintenance. CONCLUSIONS: Collectively, this study demonstrates that overexpression of PKMYT1 is always found in breast cancer and predicts unfavourable prognosis, implicating it as an appealing therapeutic target for breast carcinoma. John Wiley and Sons Inc. 2019-12-14 /pmc/articles/PMC7046476/ /pubmed/31837068 http://dx.doi.org/10.1111/cpr.12741 Text en © 2019 The Authors. Cell Proliferation Published by John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Articles
Liu, Yu
Qi, Jian
Dou, Zhen
Hu, Jiliang
Lu, Li
Dai, Haiming
Wang, Hongzhi
Yang, Wulin
Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title_full Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title_fullStr Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title_full_unstemmed Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title_short Systematic expression analysis of WEE family kinases reveals the importance of PKMYT1 in breast carcinogenesis
title_sort systematic expression analysis of wee family kinases reveals the importance of pkmyt1 in breast carcinogenesis
topic Original Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7046476/
https://www.ncbi.nlm.nih.gov/pubmed/31837068
http://dx.doi.org/10.1111/cpr.12741
work_keys_str_mv AT liuyu systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT qijian systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT douzhen systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT hujiliang systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT luli systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT daihaiming systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT wanghongzhi systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis
AT yangwulin systematicexpressionanalysisofweefamilykinasesrevealstheimportanceofpkmyt1inbreastcarcinogenesis