Cargando…
Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is as...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7050914/ https://www.ncbi.nlm.nih.gov/pubmed/32153944 http://dx.doi.org/10.1186/s40795-019-0294-7 |
_version_ | 1783502687015272448 |
---|---|
author | Shrestha, Dhruba Budhathoki, Saraswati Pokhrel, Sabi Sah, Ashok Kumar Shrestha, Raj Kumar Raya, Ganendra Bhakta Shrestha, Reena Pasakhala, Rasila Smith, Christopher Dhoubhadel, Bhim Gopal |
author_facet | Shrestha, Dhruba Budhathoki, Saraswati Pokhrel, Sabi Sah, Ashok Kumar Shrestha, Raj Kumar Raya, Ganendra Bhakta Shrestha, Reena Pasakhala, Rasila Smith, Christopher Dhoubhadel, Bhim Gopal |
author_sort | Shrestha, Dhruba |
collection | PubMed |
description | BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is associated with high neonatal mortality. METHODS: Seventy-nine pregnant women who were admitted to the Siddhi Memorial Hospital for delivery and their newborn babies were enrolled in the study. Maternal blood samples were taken before delivery while umbilical cord blood samples of their babies were taken after delivery. Serum vitamin D level and calcium level were assessed by fluorescence immunoassay using Ichromax vitamin D kit and endpoint method, respectively in the Siddhi Memorial Hospital laboratory. RESULTS: Mean +/− SD serum vitamin D and calcium levels in pregnant mother before delivery were 14.6 +/− 8.5 ng/ml and 8.0 +/− 0.5 mg/dl, respectively, and in the cord blood were 25.7 +/− 11.2 ng/ml and 8.6 +/− 0.9 mg/dl, respectively. Eighty-one percent of the mothers and 35.8% of their babies were found to have vitamin D deficiency. Although 97.5% of the pregnant women were taking calcium supplementation, serum calcium was found lower than the normal reference value in 67% of the pregnant women and 64.2% of their babies. There were a linear relationship between the maternal and baby’s serum vitamin D (P < 0.001) and calcium (P < 0.001) levels. CONCLUSION: There is high prevalence of vitamin D and calcium deficiency in pregnant mothers and newborn babies in Bhaktapur, Nepal. Pregnant women need to be supplemented with adequate amounts of these nutrients. |
format | Online Article Text |
id | pubmed-7050914 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-70509142020-03-09 Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal Shrestha, Dhruba Budhathoki, Saraswati Pokhrel, Sabi Sah, Ashok Kumar Shrestha, Raj Kumar Raya, Ganendra Bhakta Shrestha, Reena Pasakhala, Rasila Smith, Christopher Dhoubhadel, Bhim Gopal BMC Nutr Research Article BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is associated with high neonatal mortality. METHODS: Seventy-nine pregnant women who were admitted to the Siddhi Memorial Hospital for delivery and their newborn babies were enrolled in the study. Maternal blood samples were taken before delivery while umbilical cord blood samples of their babies were taken after delivery. Serum vitamin D level and calcium level were assessed by fluorescence immunoassay using Ichromax vitamin D kit and endpoint method, respectively in the Siddhi Memorial Hospital laboratory. RESULTS: Mean +/− SD serum vitamin D and calcium levels in pregnant mother before delivery were 14.6 +/− 8.5 ng/ml and 8.0 +/− 0.5 mg/dl, respectively, and in the cord blood were 25.7 +/− 11.2 ng/ml and 8.6 +/− 0.9 mg/dl, respectively. Eighty-one percent of the mothers and 35.8% of their babies were found to have vitamin D deficiency. Although 97.5% of the pregnant women were taking calcium supplementation, serum calcium was found lower than the normal reference value in 67% of the pregnant women and 64.2% of their babies. There were a linear relationship between the maternal and baby’s serum vitamin D (P < 0.001) and calcium (P < 0.001) levels. CONCLUSION: There is high prevalence of vitamin D and calcium deficiency in pregnant mothers and newborn babies in Bhaktapur, Nepal. Pregnant women need to be supplemented with adequate amounts of these nutrients. BioMed Central 2019-05-29 /pmc/articles/PMC7050914/ /pubmed/32153944 http://dx.doi.org/10.1186/s40795-019-0294-7 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Shrestha, Dhruba Budhathoki, Saraswati Pokhrel, Sabi Sah, Ashok Kumar Shrestha, Raj Kumar Raya, Ganendra Bhakta Shrestha, Reena Pasakhala, Rasila Smith, Christopher Dhoubhadel, Bhim Gopal Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title | Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title_full | Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title_fullStr | Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title_full_unstemmed | Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title_short | Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal |
title_sort | prevalence of vitamin d deficiency in pregnant women and their babies in bhaktapur, nepal |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7050914/ https://www.ncbi.nlm.nih.gov/pubmed/32153944 http://dx.doi.org/10.1186/s40795-019-0294-7 |
work_keys_str_mv | AT shresthadhruba prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT budhathokisaraswati prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT pokhrelsabi prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT sahashokkumar prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT shrestharajkumar prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT rayaganendrabhakta prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT shresthareena prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT pasakhalarasila prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT smithchristopher prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal AT dhoubhadelbhimgopal prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal |