Cargando…

Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal

BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is as...

Descripción completa

Detalles Bibliográficos
Autores principales: Shrestha, Dhruba, Budhathoki, Saraswati, Pokhrel, Sabi, Sah, Ashok Kumar, Shrestha, Raj Kumar, Raya, Ganendra Bhakta, Shrestha, Reena, Pasakhala, Rasila, Smith, Christopher, Dhoubhadel, Bhim Gopal
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7050914/
https://www.ncbi.nlm.nih.gov/pubmed/32153944
http://dx.doi.org/10.1186/s40795-019-0294-7
_version_ 1783502687015272448
author Shrestha, Dhruba
Budhathoki, Saraswati
Pokhrel, Sabi
Sah, Ashok Kumar
Shrestha, Raj Kumar
Raya, Ganendra Bhakta
Shrestha, Reena
Pasakhala, Rasila
Smith, Christopher
Dhoubhadel, Bhim Gopal
author_facet Shrestha, Dhruba
Budhathoki, Saraswati
Pokhrel, Sabi
Sah, Ashok Kumar
Shrestha, Raj Kumar
Raya, Ganendra Bhakta
Shrestha, Reena
Pasakhala, Rasila
Smith, Christopher
Dhoubhadel, Bhim Gopal
author_sort Shrestha, Dhruba
collection PubMed
description BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is associated with high neonatal mortality. METHODS: Seventy-nine pregnant women who were admitted to the Siddhi Memorial Hospital for delivery and their newborn babies were enrolled in the study. Maternal blood samples were taken before delivery while umbilical cord blood samples of their babies were taken after delivery. Serum vitamin D level and calcium level were assessed by fluorescence immunoassay using Ichromax vitamin D kit and endpoint method, respectively in the Siddhi Memorial Hospital laboratory. RESULTS: Mean +/− SD serum vitamin D and calcium levels in pregnant mother before delivery were 14.6 +/− 8.5 ng/ml and 8.0 +/− 0.5 mg/dl, respectively, and in the cord blood were 25.7 +/− 11.2 ng/ml and 8.6 +/− 0.9 mg/dl, respectively. Eighty-one percent of the mothers and 35.8% of their babies were found to have vitamin D deficiency. Although 97.5% of the pregnant women were taking calcium supplementation, serum calcium was found lower than the normal reference value in 67% of the pregnant women and 64.2% of their babies. There were a linear relationship between the maternal and baby’s serum vitamin D (P < 0.001) and calcium (P < 0.001) levels. CONCLUSION: There is high prevalence of vitamin D and calcium deficiency in pregnant mothers and newborn babies in Bhaktapur, Nepal. Pregnant women need to be supplemented with adequate amounts of these nutrients.
format Online
Article
Text
id pubmed-7050914
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-70509142020-03-09 Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal Shrestha, Dhruba Budhathoki, Saraswati Pokhrel, Sabi Sah, Ashok Kumar Shrestha, Raj Kumar Raya, Ganendra Bhakta Shrestha, Reena Pasakhala, Rasila Smith, Christopher Dhoubhadel, Bhim Gopal BMC Nutr Research Article BACKGROUND: Vitamin D deficiency has been observed worldwide in pregnant women and their newborns. Maternal vitamin D deficiency can lead to deficiency in their newborn baby and has been linked with various complications during pregnancy and delivery. There is risk of premature delivery and it is associated with high neonatal mortality. METHODS: Seventy-nine pregnant women who were admitted to the Siddhi Memorial Hospital for delivery and their newborn babies were enrolled in the study. Maternal blood samples were taken before delivery while umbilical cord blood samples of their babies were taken after delivery. Serum vitamin D level and calcium level were assessed by fluorescence immunoassay using Ichromax vitamin D kit and endpoint method, respectively in the Siddhi Memorial Hospital laboratory. RESULTS: Mean +/− SD serum vitamin D and calcium levels in pregnant mother before delivery were 14.6 +/− 8.5 ng/ml and 8.0 +/− 0.5 mg/dl, respectively, and in the cord blood were 25.7 +/− 11.2 ng/ml and 8.6 +/− 0.9 mg/dl, respectively. Eighty-one percent of the mothers and 35.8% of their babies were found to have vitamin D deficiency. Although 97.5% of the pregnant women were taking calcium supplementation, serum calcium was found lower than the normal reference value in 67% of the pregnant women and 64.2% of their babies. There were a linear relationship between the maternal and baby’s serum vitamin D (P < 0.001) and calcium (P < 0.001) levels. CONCLUSION: There is high prevalence of vitamin D and calcium deficiency in pregnant mothers and newborn babies in Bhaktapur, Nepal. Pregnant women need to be supplemented with adequate amounts of these nutrients. BioMed Central 2019-05-29 /pmc/articles/PMC7050914/ /pubmed/32153944 http://dx.doi.org/10.1186/s40795-019-0294-7 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Shrestha, Dhruba
Budhathoki, Saraswati
Pokhrel, Sabi
Sah, Ashok Kumar
Shrestha, Raj Kumar
Raya, Ganendra Bhakta
Shrestha, Reena
Pasakhala, Rasila
Smith, Christopher
Dhoubhadel, Bhim Gopal
Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title_full Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title_fullStr Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title_full_unstemmed Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title_short Prevalence of vitamin D deficiency in pregnant women and their babies in Bhaktapur, Nepal
title_sort prevalence of vitamin d deficiency in pregnant women and their babies in bhaktapur, nepal
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7050914/
https://www.ncbi.nlm.nih.gov/pubmed/32153944
http://dx.doi.org/10.1186/s40795-019-0294-7
work_keys_str_mv AT shresthadhruba prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT budhathokisaraswati prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT pokhrelsabi prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT sahashokkumar prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT shrestharajkumar prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT rayaganendrabhakta prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT shresthareena prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT pasakhalarasila prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT smithchristopher prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal
AT dhoubhadelbhimgopal prevalenceofvitaminddeficiencyinpregnantwomenandtheirbabiesinbhaktapurnepal