Cargando…

Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle

Inbreeding gives rise to continuous lengths of homozygous genotypes called runs of homozygosity (ROH) that occur when identical haplotypes are inherited from both parents. ROHs are enriched for deleterious recessive alleles and can therefore be linked to inbreeding depression, defined as decreased p...

Descripción completa

Detalles Bibliográficos
Autores principales: Martikainen, K., Koivula, M., Uimari, P.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7052207/
https://www.ncbi.nlm.nih.gov/pubmed/32123255
http://dx.doi.org/10.1038/s41598-020-60830-9
_version_ 1783502820208541696
author Martikainen, K.
Koivula, M.
Uimari, P.
author_facet Martikainen, K.
Koivula, M.
Uimari, P.
author_sort Martikainen, K.
collection PubMed
description Inbreeding gives rise to continuous lengths of homozygous genotypes called runs of homozygosity (ROH) that occur when identical haplotypes are inherited from both parents. ROHs are enriched for deleterious recessive alleles and can therefore be linked to inbreeding depression, defined as decreased phenotypic performance of the animals. However, not all ROHs within a region are expected to have harmful effects on the trait of interest. We aimed to identify ROHs that unfavourably affect female fertility and milk production traits in the Finnish Ayrshire population. The estimated effect of ROHs with the highest statistical significance varied between parities from 9 to 17 days longer intervals from calving to first insemination, from 13 to 38 days longer intervals from first to last insemination and from 0.3 to 1.0 more insemination per conception. Similarly, for milk production traits ROHs were associated with a reduction of 208 kg for milk yield, 7 kg for protein yield and 16 kg for fat yield. We also found regions where ROHs displayed unfavourable effects across multiple traits. Our findings can be exploited for more efficient control of inbreeding depression, for example by minimizing the occurrence of unfavourable haplotypes as homozygous state in breeding programmes.
format Online
Article
Text
id pubmed-7052207
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-70522072020-03-06 Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle Martikainen, K. Koivula, M. Uimari, P. Sci Rep Article Inbreeding gives rise to continuous lengths of homozygous genotypes called runs of homozygosity (ROH) that occur when identical haplotypes are inherited from both parents. ROHs are enriched for deleterious recessive alleles and can therefore be linked to inbreeding depression, defined as decreased phenotypic performance of the animals. However, not all ROHs within a region are expected to have harmful effects on the trait of interest. We aimed to identify ROHs that unfavourably affect female fertility and milk production traits in the Finnish Ayrshire population. The estimated effect of ROHs with the highest statistical significance varied between parities from 9 to 17 days longer intervals from calving to first insemination, from 13 to 38 days longer intervals from first to last insemination and from 0.3 to 1.0 more insemination per conception. Similarly, for milk production traits ROHs were associated with a reduction of 208 kg for milk yield, 7 kg for protein yield and 16 kg for fat yield. We also found regions where ROHs displayed unfavourable effects across multiple traits. Our findings can be exploited for more efficient control of inbreeding depression, for example by minimizing the occurrence of unfavourable haplotypes as homozygous state in breeding programmes. Nature Publishing Group UK 2020-03-02 /pmc/articles/PMC7052207/ /pubmed/32123255 http://dx.doi.org/10.1038/s41598-020-60830-9 Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Martikainen, K.
Koivula, M.
Uimari, P.
Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title_full Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title_fullStr Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title_full_unstemmed Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title_short Identification of runs of homozygosity affecting female fertility and milk production traits in Finnish Ayrshire cattle
title_sort identification of runs of homozygosity affecting female fertility and milk production traits in finnish ayrshire cattle
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7052207/
https://www.ncbi.nlm.nih.gov/pubmed/32123255
http://dx.doi.org/10.1038/s41598-020-60830-9
work_keys_str_mv AT martikainenk identificationofrunsofhomozygosityaffectingfemalefertilityandmilkproductiontraitsinfinnishayrshirecattle
AT koivulam identificationofrunsofhomozygosityaffectingfemalefertilityandmilkproductiontraitsinfinnishayrshirecattle
AT uimarip identificationofrunsofhomozygosityaffectingfemalefertilityandmilkproductiontraitsinfinnishayrshirecattle