Cargando…

Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis

Tie2, coded by the TEK gene, is a tyrosine kinase receptor and plays a central role in vascular stability. It was suggested that variations in the TEK gene might influence the susceptibility to asthma and allergic conjunctivitis. The aim of this study was to further investigate these suggestions, in...

Descripción completa

Detalles Bibliográficos
Autores principales: Gál, Zsófia, Gézsi, András, Molnár, Viktor, Nagy, Adrienne, Kiss, András, Sultész, Monika, Csoma, Zsuzsanna, Tamási, Lilla, Gálffy, Gabriella, Bálint, Bálint L., Póliska, Szilárd, Szalai, Csaba
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7057532/
https://www.ncbi.nlm.nih.gov/pubmed/32180797
http://dx.doi.org/10.3389/fgene.2020.00128
_version_ 1783503681202683904
author Gál, Zsófia
Gézsi, András
Molnár, Viktor
Nagy, Adrienne
Kiss, András
Sultész, Monika
Csoma, Zsuzsanna
Tamási, Lilla
Gálffy, Gabriella
Bálint, Bálint L.
Póliska, Szilárd
Szalai, Csaba
author_facet Gál, Zsófia
Gézsi, András
Molnár, Viktor
Nagy, Adrienne
Kiss, András
Sultész, Monika
Csoma, Zsuzsanna
Tamási, Lilla
Gálffy, Gabriella
Bálint, Bálint L.
Póliska, Szilárd
Szalai, Csaba
author_sort Gál, Zsófia
collection PubMed
description Tie2, coded by the TEK gene, is a tyrosine kinase receptor and plays a central role in vascular stability. It was suggested that variations in the TEK gene might influence the susceptibility to asthma and allergic conjunctivitis. The aim of this study was to further investigate these suggestions, involving different populations and to study the Tie2 related pathway on a mouse model of asthma. The discovery, stage I cohort involved 306 patients with moderate and severe allergic rhinitis, the stage II study consisted of four cohorts, namely, adult and pediatric asthmatics and corresponding controls. Altogether, there were 1,258 unrelated individuals in these cohorts, out of which 63.9% were children and 36.1% were adults. In stage I, 112 SNPs were screened in the TEK gene of the patients in order to search for associations with asthma and allergic conjunctivitis. The top associated SNPs were selected for association studies on the replication cohorts. The rs3824410 SNP was nominally associated with a reduced risk of asthma in the stage I cohort and with severe asthma within the asthmatic population (p=0.009; OR=0.48) in the replication cohort. In the stage I study, 5 SNPs were selected in conjunctivitis. Due to the low number of adult patients with conjunctivitis, only children were involved in stage II. Within the asthmatic children, the rs622232 SNP was associated with conjunctivitis in boys in the dominant model (p=0.004; OR=4.76), while the rs7034505 showed association to conjunctivitis in girls (p=0.012; OR=2.42). In the lung of a mouse model of asthma, expression changes of 10 Tie2 pathway-related genes were evaluated at three points in time. Eighty percent of the selected genes showed significant changes in their expressions at least at one time point during the process, leading from sensitization to allergic airway inflammation. The expressions of both the Tek gene and its ligands showed a reduced level at all time points. In conclusion, our results provide additional proof that the Tie2 pathway, the TEK gene and its variations might have a role in asthma and allergic conjunctivitis. The gene and its associated pathways can be potential therapeutic targets in both diseases.
format Online
Article
Text
id pubmed-7057532
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-70575322020-03-16 Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis Gál, Zsófia Gézsi, András Molnár, Viktor Nagy, Adrienne Kiss, András Sultész, Monika Csoma, Zsuzsanna Tamási, Lilla Gálffy, Gabriella Bálint, Bálint L. Póliska, Szilárd Szalai, Csaba Front Genet Genetics Tie2, coded by the TEK gene, is a tyrosine kinase receptor and plays a central role in vascular stability. It was suggested that variations in the TEK gene might influence the susceptibility to asthma and allergic conjunctivitis. The aim of this study was to further investigate these suggestions, involving different populations and to study the Tie2 related pathway on a mouse model of asthma. The discovery, stage I cohort involved 306 patients with moderate and severe allergic rhinitis, the stage II study consisted of four cohorts, namely, adult and pediatric asthmatics and corresponding controls. Altogether, there were 1,258 unrelated individuals in these cohorts, out of which 63.9% were children and 36.1% were adults. In stage I, 112 SNPs were screened in the TEK gene of the patients in order to search for associations with asthma and allergic conjunctivitis. The top associated SNPs were selected for association studies on the replication cohorts. The rs3824410 SNP was nominally associated with a reduced risk of asthma in the stage I cohort and with severe asthma within the asthmatic population (p=0.009; OR=0.48) in the replication cohort. In the stage I study, 5 SNPs were selected in conjunctivitis. Due to the low number of adult patients with conjunctivitis, only children were involved in stage II. Within the asthmatic children, the rs622232 SNP was associated with conjunctivitis in boys in the dominant model (p=0.004; OR=4.76), while the rs7034505 showed association to conjunctivitis in girls (p=0.012; OR=2.42). In the lung of a mouse model of asthma, expression changes of 10 Tie2 pathway-related genes were evaluated at three points in time. Eighty percent of the selected genes showed significant changes in their expressions at least at one time point during the process, leading from sensitization to allergic airway inflammation. The expressions of both the Tek gene and its ligands showed a reduced level at all time points. In conclusion, our results provide additional proof that the Tie2 pathway, the TEK gene and its variations might have a role in asthma and allergic conjunctivitis. The gene and its associated pathways can be potential therapeutic targets in both diseases. Frontiers Media S.A. 2020-02-27 /pmc/articles/PMC7057532/ /pubmed/32180797 http://dx.doi.org/10.3389/fgene.2020.00128 Text en Copyright © 2020 Gál, Gézsi, Molnár, Nagy, Kiss, Sultész, Csoma, Tamási, Gálffy, Bálint, Póliska and Szalai http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Genetics
Gál, Zsófia
Gézsi, András
Molnár, Viktor
Nagy, Adrienne
Kiss, András
Sultész, Monika
Csoma, Zsuzsanna
Tamási, Lilla
Gálffy, Gabriella
Bálint, Bálint L.
Póliska, Szilárd
Szalai, Csaba
Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title_full Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title_fullStr Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title_full_unstemmed Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title_short Investigation of the Possible Role of Tie2 Pathway and TEK Gene in Asthma and Allergic Conjunctivitis
title_sort investigation of the possible role of tie2 pathway and tek gene in asthma and allergic conjunctivitis
topic Genetics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7057532/
https://www.ncbi.nlm.nih.gov/pubmed/32180797
http://dx.doi.org/10.3389/fgene.2020.00128
work_keys_str_mv AT galzsofia investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT gezsiandras investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT molnarviktor investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT nagyadrienne investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT kissandras investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT sulteszmonika investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT csomazsuzsanna investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT tamasililla investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT galffygabriella investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT balintbalintl investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT poliskaszilard investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis
AT szalaicsaba investigationofthepossibleroleoftie2pathwayandtekgeneinasthmaandallergicconjunctivitis