Cargando…
Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Copernicus GmbH
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7065383/ https://www.ncbi.nlm.nih.gov/pubmed/32175460 http://dx.doi.org/10.5194/aab-61-505-2018 |
_version_ | 1783505057466023936 |
---|---|
author | Fathy, Hager A. Gouda, Eman M. Gafer, Jehan A. Galal, Mona K. Nowier, Amira M. |
author_facet | Fathy, Hager A. Gouda, Eman M. Gafer, Jehan A. Galal, Mona K. Nowier, Amira M. |
author_sort | Fathy, Hager A. |
collection | PubMed |
description | This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes. |
format | Online Article Text |
id | pubmed-7065383 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Copernicus GmbH |
record_format | MEDLINE/PubMed |
spelling | pubmed-70653832020-03-13 Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds Fathy, Hager A. Gouda, Eman M. Gafer, Jehan A. Galal, Mona K. Nowier, Amira M. Arch Anim Breed Original Study This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes. Copernicus GmbH 2018-12-20 /pmc/articles/PMC7065383/ /pubmed/32175460 http://dx.doi.org/10.5194/aab-61-505-2018 Text en Copyright: © 2018 Hager A. Fathy et al. This work is licensed under the Creative Commons Attribution 4.0 International License. To view a copy of this licence, visit https://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Original Study Fathy, Hager A. Gouda, Eman M. Gafer, Jehan A. Galal, Mona K. Nowier, Amira M. Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title | Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title_full | Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title_fullStr | Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title_full_unstemmed | Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title_short | Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds |
title_sort | genetic polymorphism in melatonin receptor 1a and arylalkylamine n-acetyltransferase and its impact on seasonal reproduction in egyptian sheep breeds |
topic | Original Study |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7065383/ https://www.ncbi.nlm.nih.gov/pubmed/32175460 http://dx.doi.org/10.5194/aab-61-505-2018 |
work_keys_str_mv | AT fathyhagera geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds AT goudaemanm geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds AT gaferjehana geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds AT galalmonak geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds AT nowieramiram geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds |