Cargando…

Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds

This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected...

Descripción completa

Detalles Bibliográficos
Autores principales: Fathy, Hager A., Gouda, Eman M., Gafer, Jehan A., Galal, Mona K., Nowier, Amira M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Copernicus GmbH 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7065383/
https://www.ncbi.nlm.nih.gov/pubmed/32175460
http://dx.doi.org/10.5194/aab-61-505-2018
_version_ 1783505057466023936
author Fathy, Hager A.
Gouda, Eman M.
Gafer, Jehan A.
Galal, Mona K.
Nowier, Amira M.
author_facet Fathy, Hager A.
Gouda, Eman M.
Gafer, Jehan A.
Galal, Mona K.
Nowier, Amira M.
author_sort Fathy, Hager A.
collection PubMed
description This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes.
format Online
Article
Text
id pubmed-7065383
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Copernicus GmbH
record_format MEDLINE/PubMed
spelling pubmed-70653832020-03-13 Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds Fathy, Hager A. Gouda, Eman M. Gafer, Jehan A. Galal, Mona K. Nowier, Amira M. Arch Anim Breed Original Study This study was carried out to detect polymorphisms in the melatonin receptor 1A (MTNR1A) and arylalkylamine N-acetyltransferase (AA-NAT) genes and their association with reproductive traits. Blood samples of 126 animals from three Egyptian sheep breeds were collected. DNA was extracted and subjected to PCR restriction fragment length polymorphism (RFLP) analysis using the RsaI and SmaI enzymes. Two alleles (C and T) and three genotypes (CC, CT and TT) for MTNR1A and for AA-NAT (A and G; GG, GA and AA) were detected. The alleles C and A and the genotypes CT and GA showed the highest frequencies for the MTNR1A and AA-NAT genes, respectively. Association analysis of the MTNR1A single nucleotide polymorphism (SNP) with ewe reproductive traits revealed significant associations in the Ossimi and Rahmani breeds with age at first lambing, and the C allele seemed to be the favorable allele. The results for the AA-NAT SNP demonstrated significant correlations in Ossimi with age at first lambing and litter size and in Rahmani with lambing interval; the G allele seemed to be the desirable allele. In the first conception season, ewes carrying CT exhibited a significantly lower age of first lambing in the unfavorable season. Additionally, GG ewes exhibited a significantly lower age of first lambing in the early favorable season, followed by the unfavorable season. To the best of our knowledge, this is the first study of these associations in Egyptian sheep breeds. In conclusion, the polymorphisms revealed in this study could be used as genetic markers to improve reproductive efficiency during the unfavorable season, and the obtained desirable genotypes could be considered in new genetic selection schemes. Copernicus GmbH 2018-12-20 /pmc/articles/PMC7065383/ /pubmed/32175460 http://dx.doi.org/10.5194/aab-61-505-2018 Text en Copyright: © 2018 Hager A. Fathy et al. This work is licensed under the Creative Commons Attribution 4.0 International License. To view a copy of this licence, visit https://creativecommons.org/licenses/by/4.0/
spellingShingle Original Study
Fathy, Hager A.
Gouda, Eman M.
Gafer, Jehan A.
Galal, Mona K.
Nowier, Amira M.
Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_full Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_fullStr Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_full_unstemmed Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_short Genetic polymorphism in melatonin receptor 1A and arylalkylamine N-acetyltransferase and its impact on seasonal reproduction in Egyptian sheep breeds
title_sort genetic polymorphism in melatonin receptor 1a and arylalkylamine n-acetyltransferase and its impact on seasonal reproduction in egyptian sheep breeds
topic Original Study
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7065383/
https://www.ncbi.nlm.nih.gov/pubmed/32175460
http://dx.doi.org/10.5194/aab-61-505-2018
work_keys_str_mv AT fathyhagera geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT goudaemanm geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT gaferjehana geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT galalmonak geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds
AT nowieramiram geneticpolymorphisminmelatoninreceptor1aandarylalkylaminenacetyltransferaseanditsimpactonseasonalreproductioninegyptiansheepbreeds