Cargando…
Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5)
The newly emerging NDM-5 confers increased antibiotic resistance and attracts extensive global attention, but the prevalence, dissemination mechanism, and clinical significance of NDM-5 among clinical Escherichia coli (E. coli) infections have not been thoroughly characterized to date. In the presen...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7069339/ https://www.ncbi.nlm.nih.gov/pubmed/32210935 http://dx.doi.org/10.3389/fmicb.2020.00334 |
_version_ | 1783505760780550144 |
---|---|
author | Zou, Hua Jia, Xiaojiong Liu, Hang Li, Shuang Wu, Xianan Huang, Shifeng |
author_facet | Zou, Hua Jia, Xiaojiong Liu, Hang Li, Shuang Wu, Xianan Huang, Shifeng |
author_sort | Zou, Hua |
collection | PubMed |
description | The newly emerging NDM-5 confers increased antibiotic resistance and attracts extensive global attention, but the prevalence, dissemination mechanism, and clinical significance of NDM-5 among clinical Escherichia coli (E. coli) infections have not been thoroughly characterized to date. In the present study, 109 unique carbapenem-resistant E. coli (CR-EC) isolates were collected in Southwest China, from 2013 to 2017, among which 41 (37.61%) CR-EC isolates were identified as NDM-5-producers, with most isolates carrying the IncF-type plasmids. Molecular epidemiological studies revealed ST167 being the most common sequence type (ST). Moreover, we described the first report of a clinical CR-EC isolate co-harboring bla(KPC–)(2) and bla(NDM–)(5), which showed a higher level of resistance to carbapenems. In addition, bla(NDM–)(5) plasmid transformation and conjugation indicated that bla(NDM–)(5) itself did confer resistance to carbapenems. Complete sequencing of the bla(NDM–)(5)-harboring IncF plasmid revealed highly conserved regions (ble(MBL)-trpF-tat) and some transposons around bla(NDM–)(5). Our findings revealed a new potential threat of NDM-5-postive CR-EC in mainland China and emphasized an urgent need to control their further spread. |
format | Online Article Text |
id | pubmed-7069339 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-70693392020-03-24 Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) Zou, Hua Jia, Xiaojiong Liu, Hang Li, Shuang Wu, Xianan Huang, Shifeng Front Microbiol Microbiology The newly emerging NDM-5 confers increased antibiotic resistance and attracts extensive global attention, but the prevalence, dissemination mechanism, and clinical significance of NDM-5 among clinical Escherichia coli (E. coli) infections have not been thoroughly characterized to date. In the present study, 109 unique carbapenem-resistant E. coli (CR-EC) isolates were collected in Southwest China, from 2013 to 2017, among which 41 (37.61%) CR-EC isolates were identified as NDM-5-producers, with most isolates carrying the IncF-type plasmids. Molecular epidemiological studies revealed ST167 being the most common sequence type (ST). Moreover, we described the first report of a clinical CR-EC isolate co-harboring bla(KPC–)(2) and bla(NDM–)(5), which showed a higher level of resistance to carbapenems. In addition, bla(NDM–)(5) plasmid transformation and conjugation indicated that bla(NDM–)(5) itself did confer resistance to carbapenems. Complete sequencing of the bla(NDM–)(5)-harboring IncF plasmid revealed highly conserved regions (ble(MBL)-trpF-tat) and some transposons around bla(NDM–)(5). Our findings revealed a new potential threat of NDM-5-postive CR-EC in mainland China and emphasized an urgent need to control their further spread. Frontiers Media S.A. 2020-03-06 /pmc/articles/PMC7069339/ /pubmed/32210935 http://dx.doi.org/10.3389/fmicb.2020.00334 Text en Copyright © 2020 Zou, Jia, Liu, Li, Wu and Huang. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Microbiology Zou, Hua Jia, Xiaojiong Liu, Hang Li, Shuang Wu, Xianan Huang, Shifeng Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title | Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title_full | Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title_fullStr | Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title_full_unstemmed | Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title_short | Emergence of NDM-5-Producing Escherichia coli in a Teaching Hospital in Chongqing, China: IncF-Type Plasmids May Contribute to the Prevalence of bla(NDM–)(5) |
title_sort | emergence of ndm-5-producing escherichia coli in a teaching hospital in chongqing, china: incf-type plasmids may contribute to the prevalence of bla(ndm–)(5) |
topic | Microbiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7069339/ https://www.ncbi.nlm.nih.gov/pubmed/32210935 http://dx.doi.org/10.3389/fmicb.2020.00334 |
work_keys_str_mv | AT zouhua emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 AT jiaxiaojiong emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 AT liuhang emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 AT lishuang emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 AT wuxianan emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 AT huangshifeng emergenceofndm5producingescherichiacoliinateachinghospitalinchongqingchinaincftypeplasmidsmaycontributetotheprevalenceofblandm5 |