Cargando…
Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway
| Formato: | Online Artículo Texto |
|---|---|
| Lenguaje: | English |
| Publicado: |
Public Library of Science
2020
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7081977/ https://www.ncbi.nlm.nih.gov/pubmed/32191704 http://dx.doi.org/10.1371/journal.pgen.1008710 |
| _version_ | 1783508265868460032 |
|---|---|
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-7081977 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2020 |
| publisher | Public Library of Science |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-70819772020-03-24 Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway PLoS Genet Correction Public Library of Science 2020-03-19 /pmc/articles/PMC7081977/ /pubmed/32191704 http://dx.doi.org/10.1371/journal.pgen.1008710 Text en © 2020 The PLOS Genetics Staff http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
| spellingShingle | Correction Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title | Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_full | Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_fullStr | Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_full_unstemmed | Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_short | Correction: Mck1 kinase is a new player in the DNA damage checkpoint pathway |
| title_sort | correction: mck1 kinase is a new player in the dna damage checkpoint pathway |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7081977/ https://www.ncbi.nlm.nih.gov/pubmed/32191704 http://dx.doi.org/10.1371/journal.pgen.1008710 |
| work_keys_str_mv | AT correctionmck1kinaseisanewplayerinthednadamagecheckpointpathway |