Cargando…
Two novel bocaparvovirus species identified in wild Himalayan marmots
Bocaparvovirus (BOV) is a genetically diverse group of DNA viruses and a possible cause of respiratory, enteric, and neurological diseases in humans and animals. Here, two highly divergent BOVs (tentatively named as Himalayan marmot BOV, HMBOV1 and HMBOV2) were identified in the livers and feces of...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Science China Press
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7089499/ https://www.ncbi.nlm.nih.gov/pubmed/29218438 http://dx.doi.org/10.1007/s11427-017-9231-4 |
_version_ | 1783509749896052736 |
---|---|
author | Ao, Yuanyun Li, Xiaoyue Li, Lili Xie, Xiaolu Jin, Dong Yu, Jiemei Lu, Shan Duan, Zhaojun |
author_facet | Ao, Yuanyun Li, Xiaoyue Li, Lili Xie, Xiaolu Jin, Dong Yu, Jiemei Lu, Shan Duan, Zhaojun |
author_sort | Ao, Yuanyun |
collection | PubMed |
description | Bocaparvovirus (BOV) is a genetically diverse group of DNA viruses and a possible cause of respiratory, enteric, and neurological diseases in humans and animals. Here, two highly divergent BOVs (tentatively named as Himalayan marmot BOV, HMBOV1 and HMBOV2) were identified in the livers and feces of wild Himalayan marmots in China, by viral metagenomic analysis. Five of 300 liver samples from Himalayan marmots were positive for HMBOV1 and five of 99 fecal samples from these animals for HMBOV2. Their nearly complete genome sequences are 4,672 and 4,887 nucleotides long, respectively, with a standard genomic organization and containing protein-coding motifs typical for BOVs. Based on their NS1, NP1, and VP1, HMBOV1 and HMBOV2 are most closely related to porcine BOV SX/1-2 (approximately 77.0%/50.0%, 50.0%/53.0%, and 79.0%/54.0% amino acid identity, respectively). Phylogenetic analysis of these three proteins showed that HMBOV1 and HMBOV2 formed two distinctly independent branches in BOVs. According to these results, HMBOV1 and HMBOV2 are two different novel species in the Bocaparvovirus genus. Their identification expands our knowledge of the genetic diversity and evolution of BOVs. Further studies are needed to investigate their potential pathogenicity and their impact on Himalayan marmots and humans. |
format | Online Article Text |
id | pubmed-7089499 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Science China Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-70894992020-03-23 Two novel bocaparvovirus species identified in wild Himalayan marmots Ao, Yuanyun Li, Xiaoyue Li, Lili Xie, Xiaolu Jin, Dong Yu, Jiemei Lu, Shan Duan, Zhaojun Sci China Life Sci Research Paper Bocaparvovirus (BOV) is a genetically diverse group of DNA viruses and a possible cause of respiratory, enteric, and neurological diseases in humans and animals. Here, two highly divergent BOVs (tentatively named as Himalayan marmot BOV, HMBOV1 and HMBOV2) were identified in the livers and feces of wild Himalayan marmots in China, by viral metagenomic analysis. Five of 300 liver samples from Himalayan marmots were positive for HMBOV1 and five of 99 fecal samples from these animals for HMBOV2. Their nearly complete genome sequences are 4,672 and 4,887 nucleotides long, respectively, with a standard genomic organization and containing protein-coding motifs typical for BOVs. Based on their NS1, NP1, and VP1, HMBOV1 and HMBOV2 are most closely related to porcine BOV SX/1-2 (approximately 77.0%/50.0%, 50.0%/53.0%, and 79.0%/54.0% amino acid identity, respectively). Phylogenetic analysis of these three proteins showed that HMBOV1 and HMBOV2 formed two distinctly independent branches in BOVs. According to these results, HMBOV1 and HMBOV2 are two different novel species in the Bocaparvovirus genus. Their identification expands our knowledge of the genetic diversity and evolution of BOVs. Further studies are needed to investigate their potential pathogenicity and their impact on Himalayan marmots and humans. Science China Press 2017-12-05 2017 /pmc/articles/PMC7089499/ /pubmed/29218438 http://dx.doi.org/10.1007/s11427-017-9231-4 Text en © Science China Press and Springer-Verlag GmbH Germany, part of Springer Nature 2017 This article is made available via the PMC Open Access Subset for unrestricted research re-use and secondary analysis in any form or by any means with acknowledgement of the original source. These permissions are granted for the duration of the World Health Organization (WHO) declaration of COVID-19 as a global pandemic. |
spellingShingle | Research Paper Ao, Yuanyun Li, Xiaoyue Li, Lili Xie, Xiaolu Jin, Dong Yu, Jiemei Lu, Shan Duan, Zhaojun Two novel bocaparvovirus species identified in wild Himalayan marmots |
title | Two novel bocaparvovirus species identified in wild Himalayan marmots |
title_full | Two novel bocaparvovirus species identified in wild Himalayan marmots |
title_fullStr | Two novel bocaparvovirus species identified in wild Himalayan marmots |
title_full_unstemmed | Two novel bocaparvovirus species identified in wild Himalayan marmots |
title_short | Two novel bocaparvovirus species identified in wild Himalayan marmots |
title_sort | two novel bocaparvovirus species identified in wild himalayan marmots |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7089499/ https://www.ncbi.nlm.nih.gov/pubmed/29218438 http://dx.doi.org/10.1007/s11427-017-9231-4 |
work_keys_str_mv | AT aoyuanyun twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT lixiaoyue twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT lilili twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT xiexiaolu twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT jindong twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT yujiemei twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT lushan twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots AT duanzhaojun twonovelbocaparvovirusspeciesidentifiedinwildhimalayanmarmots |