Cargando…

Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses

Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Xiaoling, Wang, Shufeng, Huang, Yi, Zhao, Xia, Jia, Xu, Meng, Gang, Zheng, Qian, Zhang, Mengjun, Wu, Yuzhang, Wang, Li
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7109454/
https://www.ncbi.nlm.nih.gov/pubmed/32217358
http://dx.doi.org/10.1016/j.isci.2020.100977
_version_ 1783512952845893632
author Chen, Xiaoling
Wang, Shufeng
Huang, Yi
Zhao, Xia
Jia, Xu
Meng, Gang
Zheng, Qian
Zhang, Mengjun
Wu, Yuzhang
Wang, Li
author_facet Chen, Xiaoling
Wang, Shufeng
Huang, Yi
Zhao, Xia
Jia, Xu
Meng, Gang
Zheng, Qian
Zhang, Mengjun
Wu, Yuzhang
Wang, Li
author_sort Chen, Xiaoling
collection PubMed
description Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8(+) T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA(237-244), was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8(+) T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8(+) T cell-mediated VAT inflammation.
format Online
Article
Text
id pubmed-7109454
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-71094542020-04-03 Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses Chen, Xiaoling Wang, Shufeng Huang, Yi Zhao, Xia Jia, Xu Meng, Gang Zheng, Qian Zhang, Mengjun Wu, Yuzhang Wang, Li iScience Article Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8(+) T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA(237-244), was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8(+) T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8(+) T cell-mediated VAT inflammation. Elsevier 2020-03-13 /pmc/articles/PMC7109454/ /pubmed/32217358 http://dx.doi.org/10.1016/j.isci.2020.100977 Text en © 2020 The Author(s) http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Article
Chen, Xiaoling
Wang, Shufeng
Huang, Yi
Zhao, Xia
Jia, Xu
Meng, Gang
Zheng, Qian
Zhang, Mengjun
Wu, Yuzhang
Wang, Li
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title_full Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title_fullStr Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title_full_unstemmed Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title_short Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
title_sort obesity reshapes visceral fat-derived mhc i associated-immunopeptidomes and generates antigenic peptides to drive cd8(+) t cell responses
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7109454/
https://www.ncbi.nlm.nih.gov/pubmed/32217358
http://dx.doi.org/10.1016/j.isci.2020.100977
work_keys_str_mv AT chenxiaoling obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT wangshufeng obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT huangyi obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT zhaoxia obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT jiaxu obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT menggang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT zhengqian obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT zhangmengjun obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT wuyuzhang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses
AT wangli obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses