Cargando…
Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses
Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7109454/ https://www.ncbi.nlm.nih.gov/pubmed/32217358 http://dx.doi.org/10.1016/j.isci.2020.100977 |
_version_ | 1783512952845893632 |
---|---|
author | Chen, Xiaoling Wang, Shufeng Huang, Yi Zhao, Xia Jia, Xu Meng, Gang Zheng, Qian Zhang, Mengjun Wu, Yuzhang Wang, Li |
author_facet | Chen, Xiaoling Wang, Shufeng Huang, Yi Zhao, Xia Jia, Xu Meng, Gang Zheng, Qian Zhang, Mengjun Wu, Yuzhang Wang, Li |
author_sort | Chen, Xiaoling |
collection | PubMed |
description | Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8(+) T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA(237-244), was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8(+) T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8(+) T cell-mediated VAT inflammation. |
format | Online Article Text |
id | pubmed-7109454 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-71094542020-04-03 Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses Chen, Xiaoling Wang, Shufeng Huang, Yi Zhao, Xia Jia, Xu Meng, Gang Zheng, Qian Zhang, Mengjun Wu, Yuzhang Wang, Li iScience Article Adaptive CD8(+) T cells were observed to contribute to the initiation and progression of obesity-induced visceral adipose tissue (VAT) chronic inflammation that is critically linked to metabolic disorders. Numerous peptides presented by the major histocompatibility complex (MHC) class I molecules at the cell surface are collectively termed as MHC I-associated immunopeptidome (MIP) for the interaction with CD8(+) T cells. We conducted the in-depth mapping of MIP of VAT from lean and obese mice using large-scale high-resolution mass spectrometry and observed that obesity significantly alters the landscape of VAT MIPs. Additionally, the obese VAT-exclusive MIP source proteome reflected a distinct obesity-associated signature. A peptide derived from lactate dehydrogenase A (LDHA) or B chain, named LDHA(237-244), was identified as an obese VAT-exclusive immunogenic peptide that was capable of eliciting pro-inflammatory CD8(+) T cells responses. Our findings suggest that certain immunogenic peptides generated by obesity may trigger CD8(+) T cell-mediated VAT inflammation. Elsevier 2020-03-13 /pmc/articles/PMC7109454/ /pubmed/32217358 http://dx.doi.org/10.1016/j.isci.2020.100977 Text en © 2020 The Author(s) http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Article Chen, Xiaoling Wang, Shufeng Huang, Yi Zhao, Xia Jia, Xu Meng, Gang Zheng, Qian Zhang, Mengjun Wu, Yuzhang Wang, Li Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title | Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title_full | Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title_fullStr | Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title_full_unstemmed | Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title_short | Obesity Reshapes Visceral Fat-Derived MHC I Associated-Immunopeptidomes and Generates Antigenic Peptides to Drive CD8(+) T Cell Responses |
title_sort | obesity reshapes visceral fat-derived mhc i associated-immunopeptidomes and generates antigenic peptides to drive cd8(+) t cell responses |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7109454/ https://www.ncbi.nlm.nih.gov/pubmed/32217358 http://dx.doi.org/10.1016/j.isci.2020.100977 |
work_keys_str_mv | AT chenxiaoling obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT wangshufeng obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT huangyi obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT zhaoxia obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT jiaxu obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT menggang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT zhengqian obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT zhangmengjun obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT wuyuzhang obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses AT wangli obesityreshapesvisceralfatderivedmhciassociatedimmunopeptidomesandgeneratesantigenicpeptidestodrivecd8tcellresponses |