Cargando…
Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7143814/ https://www.ncbi.nlm.nih.gov/pubmed/32156014 http://dx.doi.org/10.3390/microorganisms8030377 |
_version_ | 1783519699963740160 |
---|---|
author | Ma, Tengfei Fu, Jiani Xie, Ning Ma, Shizhen Lei, Lei Zhai, Weishuai Shen, Yingbo Sun, Chengtao Wang, Shaolin Shen, Zhangqi Wang, Yang Walsh, Timothy R. Shen, Jianzhong |
author_facet | Ma, Tengfei Fu, Jiani Xie, Ning Ma, Shizhen Lei, Lei Zhai, Weishuai Shen, Yingbo Sun, Chengtao Wang, Shaolin Shen, Zhangqi Wang, Yang Walsh, Timothy R. Shen, Jianzhong |
author_sort | Ma, Tengfei |
collection | PubMed |
description | The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being detected from diverse samples, including hospitals, communities, livestock and poultry, and the environment, suggesting that IncX3 plasmids are becoming a vital vehicle for bla(NDM) dissemination. To elucidate the fitness cost of these plasmids on the bacterial host, we collected bla(NDM)-negative strains from different sources and tested their ability to acquire the bla(NDM-5)-harboring p3R-IncX3 plasmid. We then measured changes in antimicrobial susceptibility, growth kinetics, and biofilm formation following plasmid acquisition. Overall, 70.7% (29/41) of our Enterobacteriaceae recipients successfully acquired the bla(NDM-5)-harboring p3R-IncX3 plasmid. Contrary to previous plasmid burden theory, 75.9% (22/29) of the transconjugates showed little fitness cost as a result of plasmid acquisition, with 6.9% (2/29) of strains exhibiting enhanced growth compared with their respective wild-type strains. Following plasmid acquisition, all transconjugates demonstrated resistance to most β-lactams, while several strains showed enhanced biofilm formation, further complicating treatment and prevention measures. Moreover, the highly virulent Escherichia coli sequence type 131 strain that already harbored mcr-1 also demonstrated the ability to acquire the bla(NDM-5)-carrying p3R-IncX3 plasmid, resulting in further limited therapeutic options. This low fitness cost may partly explain the rapid global dissemination of bla(NDM-5)-harboring IncX3 plasmids. Our study highlights the growing threat of IncX3 plasmids in spreading bla(NDM-5). |
format | Online Article Text |
id | pubmed-7143814 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-71438142020-04-14 Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae Ma, Tengfei Fu, Jiani Xie, Ning Ma, Shizhen Lei, Lei Zhai, Weishuai Shen, Yingbo Sun, Chengtao Wang, Shaolin Shen, Zhangqi Wang, Yang Walsh, Timothy R. Shen, Jianzhong Microorganisms Article The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being detected from diverse samples, including hospitals, communities, livestock and poultry, and the environment, suggesting that IncX3 plasmids are becoming a vital vehicle for bla(NDM) dissemination. To elucidate the fitness cost of these plasmids on the bacterial host, we collected bla(NDM)-negative strains from different sources and tested their ability to acquire the bla(NDM-5)-harboring p3R-IncX3 plasmid. We then measured changes in antimicrobial susceptibility, growth kinetics, and biofilm formation following plasmid acquisition. Overall, 70.7% (29/41) of our Enterobacteriaceae recipients successfully acquired the bla(NDM-5)-harboring p3R-IncX3 plasmid. Contrary to previous plasmid burden theory, 75.9% (22/29) of the transconjugates showed little fitness cost as a result of plasmid acquisition, with 6.9% (2/29) of strains exhibiting enhanced growth compared with their respective wild-type strains. Following plasmid acquisition, all transconjugates demonstrated resistance to most β-lactams, while several strains showed enhanced biofilm formation, further complicating treatment and prevention measures. Moreover, the highly virulent Escherichia coli sequence type 131 strain that already harbored mcr-1 also demonstrated the ability to acquire the bla(NDM-5)-carrying p3R-IncX3 plasmid, resulting in further limited therapeutic options. This low fitness cost may partly explain the rapid global dissemination of bla(NDM-5)-harboring IncX3 plasmids. Our study highlights the growing threat of IncX3 plasmids in spreading bla(NDM-5). MDPI 2020-03-07 /pmc/articles/PMC7143814/ /pubmed/32156014 http://dx.doi.org/10.3390/microorganisms8030377 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Ma, Tengfei Fu, Jiani Xie, Ning Ma, Shizhen Lei, Lei Zhai, Weishuai Shen, Yingbo Sun, Chengtao Wang, Shaolin Shen, Zhangqi Wang, Yang Walsh, Timothy R. Shen, Jianzhong Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title | Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title_full | Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title_fullStr | Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title_full_unstemmed | Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title_short | Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae |
title_sort | fitness cost of bla(ndm-5)-carrying p3r-incx3 plasmids in wild-type ndm-free enterobacteriaceae |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7143814/ https://www.ncbi.nlm.nih.gov/pubmed/32156014 http://dx.doi.org/10.3390/microorganisms8030377 |
work_keys_str_mv | AT matengfei fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT fujiani fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT xiening fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT mashizhen fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT leilei fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT zhaiweishuai fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT shenyingbo fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT sunchengtao fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT wangshaolin fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT shenzhangqi fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT wangyang fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT walshtimothyr fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae AT shenjianzhong fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae |