Cargando…

Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae

The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being...

Descripción completa

Detalles Bibliográficos
Autores principales: Ma, Tengfei, Fu, Jiani, Xie, Ning, Ma, Shizhen, Lei, Lei, Zhai, Weishuai, Shen, Yingbo, Sun, Chengtao, Wang, Shaolin, Shen, Zhangqi, Wang, Yang, Walsh, Timothy R., Shen, Jianzhong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7143814/
https://www.ncbi.nlm.nih.gov/pubmed/32156014
http://dx.doi.org/10.3390/microorganisms8030377
_version_ 1783519699963740160
author Ma, Tengfei
Fu, Jiani
Xie, Ning
Ma, Shizhen
Lei, Lei
Zhai, Weishuai
Shen, Yingbo
Sun, Chengtao
Wang, Shaolin
Shen, Zhangqi
Wang, Yang
Walsh, Timothy R.
Shen, Jianzhong
author_facet Ma, Tengfei
Fu, Jiani
Xie, Ning
Ma, Shizhen
Lei, Lei
Zhai, Weishuai
Shen, Yingbo
Sun, Chengtao
Wang, Shaolin
Shen, Zhangqi
Wang, Yang
Walsh, Timothy R.
Shen, Jianzhong
author_sort Ma, Tengfei
collection PubMed
description The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being detected from diverse samples, including hospitals, communities, livestock and poultry, and the environment, suggesting that IncX3 plasmids are becoming a vital vehicle for bla(NDM) dissemination. To elucidate the fitness cost of these plasmids on the bacterial host, we collected bla(NDM)-negative strains from different sources and tested their ability to acquire the bla(NDM-5)-harboring p3R-IncX3 plasmid. We then measured changes in antimicrobial susceptibility, growth kinetics, and biofilm formation following plasmid acquisition. Overall, 70.7% (29/41) of our Enterobacteriaceae recipients successfully acquired the bla(NDM-5)-harboring p3R-IncX3 plasmid. Contrary to previous plasmid burden theory, 75.9% (22/29) of the transconjugates showed little fitness cost as a result of plasmid acquisition, with 6.9% (2/29) of strains exhibiting enhanced growth compared with their respective wild-type strains. Following plasmid acquisition, all transconjugates demonstrated resistance to most β-lactams, while several strains showed enhanced biofilm formation, further complicating treatment and prevention measures. Moreover, the highly virulent Escherichia coli sequence type 131 strain that already harbored mcr-1 also demonstrated the ability to acquire the bla(NDM-5)-carrying p3R-IncX3 plasmid, resulting in further limited therapeutic options. This low fitness cost may partly explain the rapid global dissemination of bla(NDM-5)-harboring IncX3 plasmids. Our study highlights the growing threat of IncX3 plasmids in spreading bla(NDM-5).
format Online
Article
Text
id pubmed-7143814
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-71438142020-04-14 Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae Ma, Tengfei Fu, Jiani Xie, Ning Ma, Shizhen Lei, Lei Zhai, Weishuai Shen, Yingbo Sun, Chengtao Wang, Shaolin Shen, Zhangqi Wang, Yang Walsh, Timothy R. Shen, Jianzhong Microorganisms Article The wide dissemination of New Delhi metallo-β-lactamase genes (bla(NDM)) has resulted in the treatment failure of most available β-lactam antibiotics, with IncX3-type bla(NDM-5)-carrying plasmids recognised as having spread worldwide. In China, bacteria carrying these plasmids are increasingly being detected from diverse samples, including hospitals, communities, livestock and poultry, and the environment, suggesting that IncX3 plasmids are becoming a vital vehicle for bla(NDM) dissemination. To elucidate the fitness cost of these plasmids on the bacterial host, we collected bla(NDM)-negative strains from different sources and tested their ability to acquire the bla(NDM-5)-harboring p3R-IncX3 plasmid. We then measured changes in antimicrobial susceptibility, growth kinetics, and biofilm formation following plasmid acquisition. Overall, 70.7% (29/41) of our Enterobacteriaceae recipients successfully acquired the bla(NDM-5)-harboring p3R-IncX3 plasmid. Contrary to previous plasmid burden theory, 75.9% (22/29) of the transconjugates showed little fitness cost as a result of plasmid acquisition, with 6.9% (2/29) of strains exhibiting enhanced growth compared with their respective wild-type strains. Following plasmid acquisition, all transconjugates demonstrated resistance to most β-lactams, while several strains showed enhanced biofilm formation, further complicating treatment and prevention measures. Moreover, the highly virulent Escherichia coli sequence type 131 strain that already harbored mcr-1 also demonstrated the ability to acquire the bla(NDM-5)-carrying p3R-IncX3 plasmid, resulting in further limited therapeutic options. This low fitness cost may partly explain the rapid global dissemination of bla(NDM-5)-harboring IncX3 plasmids. Our study highlights the growing threat of IncX3 plasmids in spreading bla(NDM-5). MDPI 2020-03-07 /pmc/articles/PMC7143814/ /pubmed/32156014 http://dx.doi.org/10.3390/microorganisms8030377 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Ma, Tengfei
Fu, Jiani
Xie, Ning
Ma, Shizhen
Lei, Lei
Zhai, Weishuai
Shen, Yingbo
Sun, Chengtao
Wang, Shaolin
Shen, Zhangqi
Wang, Yang
Walsh, Timothy R.
Shen, Jianzhong
Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title_full Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title_fullStr Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title_full_unstemmed Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title_short Fitness Cost of bla(NDM-5)-Carrying p3R-IncX3 Plasmids in Wild-Type NDM-Free Enterobacteriaceae
title_sort fitness cost of bla(ndm-5)-carrying p3r-incx3 plasmids in wild-type ndm-free enterobacteriaceae
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7143814/
https://www.ncbi.nlm.nih.gov/pubmed/32156014
http://dx.doi.org/10.3390/microorganisms8030377
work_keys_str_mv AT matengfei fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT fujiani fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT xiening fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT mashizhen fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT leilei fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT zhaiweishuai fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT shenyingbo fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT sunchengtao fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT wangshaolin fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT shenzhangqi fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT wangyang fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT walshtimothyr fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae
AT shenjianzhong fitnesscostofblandm5carryingp3rincx3plasmidsinwildtypendmfreeenterobacteriaceae