Cargando…

The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review

Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Xiuhua, Yang, Yahui, Yuan, Yiru, Liu, Lin, Meng, Tao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7149372/
https://www.ncbi.nlm.nih.gov/pubmed/32309433
http://dx.doi.org/10.1155/2020/4808072
_version_ 1783520798292574208
author Yang, Xiuhua
Yang, Yahui
Yuan, Yiru
Liu, Lin
Meng, Tao
author_facet Yang, Xiuhua
Yang, Yahui
Yuan, Yiru
Liu, Lin
Meng, Tao
author_sort Yang, Xiuhua
collection PubMed
description Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of blood flow results in lowering the nutrients and oxygen received by the fetus and augmenting the placental pressure in PE. Decidual immune cells, especially uterine natural killer (uNK) cells, are involved in the process of placentation. Decidual NK (dNK) cells significantly contribute to the vascular remodeling through the secretion of cytokines and angiogenic mediators in normal placental development. The abnormal activation of NK cells in both the peripheral blood and the decidua was counted among the causes leading to PE. The correlation existing between maternal killer cell immunoglobulin-like receptor (KIR) and HLA-C in trophoblast cells constitutes a robust evidence for the genetic etiology of PE. The combinations of the two kinds of gene systems, together with the KIR genotype in the mother and the HLA-C group in her fetus, are likely to exactly decide the pregnancy outcome. The women, who have the inappropriate match of KIR/HLA-C, are likely to be prone to the augmented risk of PE. However, the combinations of KIR/HLA-C in PE undergo ethnic changes. The extensive prospective research works in Europe, Asia, and Africa are required for providing more findings in PE patients.
format Online
Article
Text
id pubmed-7149372
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-71493722020-04-18 The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review Yang, Xiuhua Yang, Yahui Yuan, Yiru Liu, Lin Meng, Tao Biomed Res Int Review Article Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of blood flow results in lowering the nutrients and oxygen received by the fetus and augmenting the placental pressure in PE. Decidual immune cells, especially uterine natural killer (uNK) cells, are involved in the process of placentation. Decidual NK (dNK) cells significantly contribute to the vascular remodeling through the secretion of cytokines and angiogenic mediators in normal placental development. The abnormal activation of NK cells in both the peripheral blood and the decidua was counted among the causes leading to PE. The correlation existing between maternal killer cell immunoglobulin-like receptor (KIR) and HLA-C in trophoblast cells constitutes a robust evidence for the genetic etiology of PE. The combinations of the two kinds of gene systems, together with the KIR genotype in the mother and the HLA-C group in her fetus, are likely to exactly decide the pregnancy outcome. The women, who have the inappropriate match of KIR/HLA-C, are likely to be prone to the augmented risk of PE. However, the combinations of KIR/HLA-C in PE undergo ethnic changes. The extensive prospective research works in Europe, Asia, and Africa are required for providing more findings in PE patients. Hindawi 2020-03-28 /pmc/articles/PMC7149372/ /pubmed/32309433 http://dx.doi.org/10.1155/2020/4808072 Text en Copyright © 2020 Xiuhua Yang et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Article
Yang, Xiuhua
Yang, Yahui
Yuan, Yiru
Liu, Lin
Meng, Tao
The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title_full The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title_fullStr The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title_full_unstemmed The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title_short The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
title_sort roles of uterine natural killer (nk) cells and kir/hla-c combination in the development of preeclampsia: a systematic review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7149372/
https://www.ncbi.nlm.nih.gov/pubmed/32309433
http://dx.doi.org/10.1155/2020/4808072
work_keys_str_mv AT yangxiuhua therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT yangyahui therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT yuanyiru therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT liulin therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT mengtao therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT yangxiuhua rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT yangyahui rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT yuanyiru rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT liulin rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview
AT mengtao rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview