Cargando…
The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review
Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7149372/ https://www.ncbi.nlm.nih.gov/pubmed/32309433 http://dx.doi.org/10.1155/2020/4808072 |
_version_ | 1783520798292574208 |
---|---|
author | Yang, Xiuhua Yang, Yahui Yuan, Yiru Liu, Lin Meng, Tao |
author_facet | Yang, Xiuhua Yang, Yahui Yuan, Yiru Liu, Lin Meng, Tao |
author_sort | Yang, Xiuhua |
collection | PubMed |
description | Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of blood flow results in lowering the nutrients and oxygen received by the fetus and augmenting the placental pressure in PE. Decidual immune cells, especially uterine natural killer (uNK) cells, are involved in the process of placentation. Decidual NK (dNK) cells significantly contribute to the vascular remodeling through the secretion of cytokines and angiogenic mediators in normal placental development. The abnormal activation of NK cells in both the peripheral blood and the decidua was counted among the causes leading to PE. The correlation existing between maternal killer cell immunoglobulin-like receptor (KIR) and HLA-C in trophoblast cells constitutes a robust evidence for the genetic etiology of PE. The combinations of the two kinds of gene systems, together with the KIR genotype in the mother and the HLA-C group in her fetus, are likely to exactly decide the pregnancy outcome. The women, who have the inappropriate match of KIR/HLA-C, are likely to be prone to the augmented risk of PE. However, the combinations of KIR/HLA-C in PE undergo ethnic changes. The extensive prospective research works in Europe, Asia, and Africa are required for providing more findings in PE patients. |
format | Online Article Text |
id | pubmed-7149372 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-71493722020-04-18 The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review Yang, Xiuhua Yang, Yahui Yuan, Yiru Liu, Lin Meng, Tao Biomed Res Int Review Article Preeclampsia (PE) is termed as a systemic disease that involves multiple organs; however, the exact etiology is still quite unclear. It is believed that the poor remodeling of uterine spiral arteries triggers PE, thereby causing failed placentation and producing inflammatory factors. The decline of blood flow results in lowering the nutrients and oxygen received by the fetus and augmenting the placental pressure in PE. Decidual immune cells, especially uterine natural killer (uNK) cells, are involved in the process of placentation. Decidual NK (dNK) cells significantly contribute to the vascular remodeling through the secretion of cytokines and angiogenic mediators in normal placental development. The abnormal activation of NK cells in both the peripheral blood and the decidua was counted among the causes leading to PE. The correlation existing between maternal killer cell immunoglobulin-like receptor (KIR) and HLA-C in trophoblast cells constitutes a robust evidence for the genetic etiology of PE. The combinations of the two kinds of gene systems, together with the KIR genotype in the mother and the HLA-C group in her fetus, are likely to exactly decide the pregnancy outcome. The women, who have the inappropriate match of KIR/HLA-C, are likely to be prone to the augmented risk of PE. However, the combinations of KIR/HLA-C in PE undergo ethnic changes. The extensive prospective research works in Europe, Asia, and Africa are required for providing more findings in PE patients. Hindawi 2020-03-28 /pmc/articles/PMC7149372/ /pubmed/32309433 http://dx.doi.org/10.1155/2020/4808072 Text en Copyright © 2020 Xiuhua Yang et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Review Article Yang, Xiuhua Yang, Yahui Yuan, Yiru Liu, Lin Meng, Tao The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title | The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title_full | The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title_fullStr | The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title_full_unstemmed | The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title_short | The Roles of Uterine Natural Killer (NK) Cells and KIR/HLA-C Combination in the Development of Preeclampsia: A Systematic Review |
title_sort | roles of uterine natural killer (nk) cells and kir/hla-c combination in the development of preeclampsia: a systematic review |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7149372/ https://www.ncbi.nlm.nih.gov/pubmed/32309433 http://dx.doi.org/10.1155/2020/4808072 |
work_keys_str_mv | AT yangxiuhua therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT yangyahui therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT yuanyiru therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT liulin therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT mengtao therolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT yangxiuhua rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT yangyahui rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT yuanyiru rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT liulin rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview AT mengtao rolesofuterinenaturalkillernkcellsandkirhlaccombinationinthedevelopmentofpreeclampsiaasystematicreview |