Cargando…
Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific l...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7150868/ https://www.ncbi.nlm.nih.gov/pubmed/32188060 http://dx.doi.org/10.3390/toxins12030187 |
_version_ | 1783521117379493888 |
---|---|
author | Lang Balija, Maja Leonardi, Adrijana Brgles, Marija Sviben, Dora Kurtović, Tihana Halassy, Beata Križaj, Igor |
author_facet | Lang Balija, Maja Leonardi, Adrijana Brgles, Marija Sviben, Dora Kurtović, Tihana Halassy, Beata Križaj, Igor |
author_sort | Lang Balija, Maja |
collection | PubMed |
description | The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific literature on Vipera ursinii deals mostly with the morphology, ecology and distribution range of this snake, due to the species’ conservation issues, while the toxinological aspects of its venom have not so far been investigated. Here we report on the composition and biological activity of the Vipera ursinii ssp. venom. Using a proteomics approach, we have identified 25 proteins in the venom that belong to seven protein families: snake venom metalloproteinase, serine protease, secreted phospholipase A(2), cysteine-rich secretory protein, snake C-type lectin-like protein, serine protease inhibitor and nerve growth factor. The Vipera ursinii ssp. venom was found to be distinctively insecticidal. Its lethal toxicity towards crickets was more than five times greater than that of Vipera ammodytes ammodytes venom, while the opposite held in mice. Interestingly, the mode of dying after injecting a mouse with Vipera ursinii ssp. venom may suggest the presence of a neurotoxic component. Neurotoxic effects of European vipers have so far been ascribed exclusively to ammodytoxins and ammodytoxin-like basic secreted phospholipases A(2). Structural and immunological analyses of the Vipera ursinii ssp. venom, however, confirmed that ammodytoxin-like proteins are not present in this venom. |
format | Online Article Text |
id | pubmed-7150868 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-71508682020-04-20 Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia Lang Balija, Maja Leonardi, Adrijana Brgles, Marija Sviben, Dora Kurtović, Tihana Halassy, Beata Križaj, Igor Toxins (Basel) Article The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific literature on Vipera ursinii deals mostly with the morphology, ecology and distribution range of this snake, due to the species’ conservation issues, while the toxinological aspects of its venom have not so far been investigated. Here we report on the composition and biological activity of the Vipera ursinii ssp. venom. Using a proteomics approach, we have identified 25 proteins in the venom that belong to seven protein families: snake venom metalloproteinase, serine protease, secreted phospholipase A(2), cysteine-rich secretory protein, snake C-type lectin-like protein, serine protease inhibitor and nerve growth factor. The Vipera ursinii ssp. venom was found to be distinctively insecticidal. Its lethal toxicity towards crickets was more than five times greater than that of Vipera ammodytes ammodytes venom, while the opposite held in mice. Interestingly, the mode of dying after injecting a mouse with Vipera ursinii ssp. venom may suggest the presence of a neurotoxic component. Neurotoxic effects of European vipers have so far been ascribed exclusively to ammodytoxins and ammodytoxin-like basic secreted phospholipases A(2). Structural and immunological analyses of the Vipera ursinii ssp. venom, however, confirmed that ammodytoxin-like proteins are not present in this venom. MDPI 2020-03-16 /pmc/articles/PMC7150868/ /pubmed/32188060 http://dx.doi.org/10.3390/toxins12030187 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Lang Balija, Maja Leonardi, Adrijana Brgles, Marija Sviben, Dora Kurtović, Tihana Halassy, Beata Križaj, Igor Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title | Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title_full | Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title_fullStr | Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title_full_unstemmed | Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title_short | Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia |
title_sort | biological activities and proteomic profile of the venom of vipera ursinii ssp., a very rare karst viper from croatia |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7150868/ https://www.ncbi.nlm.nih.gov/pubmed/32188060 http://dx.doi.org/10.3390/toxins12030187 |
work_keys_str_mv | AT langbalijamaja biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT leonardiadrijana biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT brglesmarija biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT svibendora biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT kurtovictihana biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT halassybeata biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia AT krizajigor biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia |