Cargando…

Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia

The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific l...

Descripción completa

Detalles Bibliográficos
Autores principales: Lang Balija, Maja, Leonardi, Adrijana, Brgles, Marija, Sviben, Dora, Kurtović, Tihana, Halassy, Beata, Križaj, Igor
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7150868/
https://www.ncbi.nlm.nih.gov/pubmed/32188060
http://dx.doi.org/10.3390/toxins12030187
_version_ 1783521117379493888
author Lang Balija, Maja
Leonardi, Adrijana
Brgles, Marija
Sviben, Dora
Kurtović, Tihana
Halassy, Beata
Križaj, Igor
author_facet Lang Balija, Maja
Leonardi, Adrijana
Brgles, Marija
Sviben, Dora
Kurtović, Tihana
Halassy, Beata
Križaj, Igor
author_sort Lang Balija, Maja
collection PubMed
description The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific literature on Vipera ursinii deals mostly with the morphology, ecology and distribution range of this snake, due to the species’ conservation issues, while the toxinological aspects of its venom have not so far been investigated. Here we report on the composition and biological activity of the Vipera ursinii ssp. venom. Using a proteomics approach, we have identified 25 proteins in the venom that belong to seven protein families: snake venom metalloproteinase, serine protease, secreted phospholipase A(2), cysteine-rich secretory protein, snake C-type lectin-like protein, serine protease inhibitor and nerve growth factor. The Vipera ursinii ssp. venom was found to be distinctively insecticidal. Its lethal toxicity towards crickets was more than five times greater than that of Vipera ammodytes ammodytes venom, while the opposite held in mice. Interestingly, the mode of dying after injecting a mouse with Vipera ursinii ssp. venom may suggest the presence of a neurotoxic component. Neurotoxic effects of European vipers have so far been ascribed exclusively to ammodytoxins and ammodytoxin-like basic secreted phospholipases A(2). Structural and immunological analyses of the Vipera ursinii ssp. venom, however, confirmed that ammodytoxin-like proteins are not present in this venom.
format Online
Article
Text
id pubmed-7150868
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-71508682020-04-20 Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia Lang Balija, Maja Leonardi, Adrijana Brgles, Marija Sviben, Dora Kurtović, Tihana Halassy, Beata Križaj, Igor Toxins (Basel) Article The karst viper (Vipera ursinii ssp.) favours high-mountain dry grasslands in southern and south-eastern Croatia. It is medically less important than other Vipera species, because of its remote habitat and the very small amount of venom that it injects by its relatively short fangs. The scientific literature on Vipera ursinii deals mostly with the morphology, ecology and distribution range of this snake, due to the species’ conservation issues, while the toxinological aspects of its venom have not so far been investigated. Here we report on the composition and biological activity of the Vipera ursinii ssp. venom. Using a proteomics approach, we have identified 25 proteins in the venom that belong to seven protein families: snake venom metalloproteinase, serine protease, secreted phospholipase A(2), cysteine-rich secretory protein, snake C-type lectin-like protein, serine protease inhibitor and nerve growth factor. The Vipera ursinii ssp. venom was found to be distinctively insecticidal. Its lethal toxicity towards crickets was more than five times greater than that of Vipera ammodytes ammodytes venom, while the opposite held in mice. Interestingly, the mode of dying after injecting a mouse with Vipera ursinii ssp. venom may suggest the presence of a neurotoxic component. Neurotoxic effects of European vipers have so far been ascribed exclusively to ammodytoxins and ammodytoxin-like basic secreted phospholipases A(2). Structural and immunological analyses of the Vipera ursinii ssp. venom, however, confirmed that ammodytoxin-like proteins are not present in this venom. MDPI 2020-03-16 /pmc/articles/PMC7150868/ /pubmed/32188060 http://dx.doi.org/10.3390/toxins12030187 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Lang Balija, Maja
Leonardi, Adrijana
Brgles, Marija
Sviben, Dora
Kurtović, Tihana
Halassy, Beata
Križaj, Igor
Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title_full Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title_fullStr Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title_full_unstemmed Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title_short Biological Activities and Proteomic Profile of the Venom of Vipera ursinii ssp., a very Rare Karst Viper from Croatia
title_sort biological activities and proteomic profile of the venom of vipera ursinii ssp., a very rare karst viper from croatia
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7150868/
https://www.ncbi.nlm.nih.gov/pubmed/32188060
http://dx.doi.org/10.3390/toxins12030187
work_keys_str_mv AT langbalijamaja biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT leonardiadrijana biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT brglesmarija biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT svibendora biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT kurtovictihana biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT halassybeata biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia
AT krizajigor biologicalactivitiesandproteomicprofileofthevenomofviperaursiniisspaveryrarekarstviperfromcroatia