First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity

We report a new positive-sense single-stranded RNA (ss RNA+) virus from the brown citrus aphid Aphis citricidus. The 20,300 nucleotide (nt)-long viral genome contains five open-reading frames and encodes six conserved domains (TM2, 3CLpro, TM3, RdRp, Zm, and HEL1). Phylogenetic analysis and amino ac...

Descripción completa

Detalles Bibliográficos
Autores principales: Chang, Tengyu, Guo, Mengmeng, Zhang, Wei, Niu, Jinzhi, Wang, Jin-Jun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2020
Materias:
Short Communication
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7153580/
https://www.ncbi.nlm.nih.gov/pubmed/32282036
http://dx.doi.org/10.1093/jisesa/ieaa022
_version_ 1783521675044716544
author Chang, Tengyu
Guo, Mengmeng
Zhang, Wei
Niu, Jinzhi
Wang, Jin-Jun
author_facet Chang, Tengyu
Guo, Mengmeng
Zhang, Wei
Niu, Jinzhi
Wang, Jin-Jun
author_sort Chang, Tengyu
collection PubMed
description We report a new positive-sense single-stranded RNA (ss RNA+) virus from the brown citrus aphid Aphis citricidus. The 20,300 nucleotide (nt)-long viral genome contains five open-reading frames and encodes six conserved domains (TM2, 3CLpro, TM3, RdRp, Zm, and HEL1). Phylogenetic analysis and amino acid sequence analysis revealed this virus might belong to an unassigned genus in the family Mesoniviridae. The presence of the virus was also confirmed in the field population. Importantly, analysis of the virus-derived small RNAs showed a 22-nt peak, implying that viral infection triggers the small interfering RNA pathway as antiviral immunity in aphids. This is the first report of a mesonivirus in invertebrates other than mosquitoes.
format Online
Article
Text
id pubmed-7153580
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-71535802020-04-17 First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity Chang, Tengyu Guo, Mengmeng Zhang, Wei Niu, Jinzhi Wang, Jin-Jun J Insect Sci Short Communication We report a new positive-sense single-stranded RNA (ss RNA+) virus from the brown citrus aphid Aphis citricidus. The 20,300 nucleotide (nt)-long viral genome contains five open-reading frames and encodes six conserved domains (TM2, 3CLpro, TM3, RdRp, Zm, and HEL1). Phylogenetic analysis and amino acid sequence analysis revealed this virus might belong to an unassigned genus in the family Mesoniviridae. The presence of the virus was also confirmed in the field population. Importantly, analysis of the virus-derived small RNAs showed a 22-nt peak, implying that viral infection triggers the small interfering RNA pathway as antiviral immunity in aphids. This is the first report of a mesonivirus in invertebrates other than mosquitoes. Oxford University Press 2020-04-13 /pmc/articles/PMC7153580/ /pubmed/32282036 http://dx.doi.org/10.1093/jisesa/ieaa022 Text en © The Author(s) 2020. Published by Oxford University Press on behalf of Entomological Society of America. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Short Communication
Chang, Tengyu
Guo, Mengmeng
Zhang, Wei
Niu, Jinzhi
Wang, Jin-Jun
First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title_full First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title_fullStr First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title_full_unstemmed First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title_short First Report of a Mesonivirus and Its Derived Small RNAs in an Aphid Species Aphis citricidus (Hemiptera: Aphididae), Implying Viral Infection Activity
title_sort first report of a mesonivirus and its derived small rnas in an aphid species aphis citricidus (hemiptera: aphididae), implying viral infection activity
topic Short Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7153580/
https://www.ncbi.nlm.nih.gov/pubmed/32282036
http://dx.doi.org/10.1093/jisesa/ieaa022
work_keys_str_mv AT changtengyu firstreportofamesonivirusanditsderivedsmallrnasinanaphidspeciesaphiscitricidushemipteraaphididaeimplyingviralinfectionactivity
AT guomengmeng firstreportofamesonivirusanditsderivedsmallrnasinanaphidspeciesaphiscitricidushemipteraaphididaeimplyingviralinfectionactivity
AT zhangwei firstreportofamesonivirusanditsderivedsmallrnasinanaphidspeciesaphiscitricidushemipteraaphididaeimplyingviralinfectionactivity
AT niujinzhi firstreportofamesonivirusanditsderivedsmallrnasinanaphidspeciesaphiscitricidushemipteraaphididaeimplyingviralinfectionactivity
AT wangjinjun firstreportofamesonivirusanditsderivedsmallrnasinanaphidspeciesaphiscitricidushemipteraaphididaeimplyingviralinfectionactivity

Ejemplares similares