Cargando…

Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa

BACKGROUND: Lymphatic filariasis (LF) is widely endemic in Côte d’Ivoire, and elimination as public health problem (EPHP) is based on annual mass drug administration (MDA) using ivermectin and albendazole. To guide EPHP efforts, we evaluated Wuchereria bancrofti infection indices among humans, and m...

Descripción completa

Detalles Bibliográficos
Autores principales: Yokoly, Firmain N., Zahouli, Julien B. Z., Méite, Aboulaye, Opoku, Millicent, Kouassi, Bernard L., de Souza, Dziedzom K., Bockarie, Moses, Koudou, Benjamin G.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7153895/
https://www.ncbi.nlm.nih.gov/pubmed/32282840
http://dx.doi.org/10.1371/journal.pone.0231541
_version_ 1783521730686353408
author Yokoly, Firmain N.
Zahouli, Julien B. Z.
Méite, Aboulaye
Opoku, Millicent
Kouassi, Bernard L.
de Souza, Dziedzom K.
Bockarie, Moses
Koudou, Benjamin G.
author_facet Yokoly, Firmain N.
Zahouli, Julien B. Z.
Méite, Aboulaye
Opoku, Millicent
Kouassi, Bernard L.
de Souza, Dziedzom K.
Bockarie, Moses
Koudou, Benjamin G.
author_sort Yokoly, Firmain N.
collection PubMed
description BACKGROUND: Lymphatic filariasis (LF) is widely endemic in Côte d’Ivoire, and elimination as public health problem (EPHP) is based on annual mass drug administration (MDA) using ivermectin and albendazole. To guide EPHP efforts, we evaluated Wuchereria bancrofti infection indices among humans, and mosquito vectors after four rounds of MDA in four cross-border health districts of Côte d’Ivoire. METHODOLOGY: We monitored people and mosquitoes for W. bancrofti infections in the cross-border health districts of Aboisso, Bloléquin, Odienné and Ouangolodougou, Côte d’Ivoire. W. bancrofti circulating filarial antigen (CFA) was identified using filariasis test strips, and antigen-positive individuals were screened for microfilaremia. Moreover, filarial mosquito vectors were sampled using window exit traps and pyrethrum sprays, and identified morphologically at species level. Anopheles gambiae s.l. and Culex quinquefasciatus females were analyzed for W. bancrofti infection using polymerase chain reaction (PCR) technique. PRINCIPAL FINDINGS: Overall, we found a substantial decline in W. bancrofti infection indices after four rounds of MDA compared to pre-MDA baseline data. CFA prevalence fell from 3.38–5.50% during pre-MDA to 0.00–1.53% after MDA interventions. No subjects had detectable levels of CFA in Ouangolodougou. Moreover, post-MDA CFA prevalence was very low, and below the 1% elimination threshold in Aboisso (0.19%) and Odienné (0.49%). Conversely, CFA prevalence remained above 1% in Bloléquin (1.53%). W. bancrofti microfilariae (Mf) were not found in Aboisso, Bloléquin, and Ouangolodougou, except for Odienné with low prevalence (0.16%; n = 613) and microfilaremia of 32.0 Mf/mL. No An. gambiae s.l. and Cx. quinquefasciatus pools were infected with W. bancrofti in Bloléquin and Ouangolodougou, while they exhibited low infection rates in Aboisso (1% and 0.07%), and Odienné (0.08% and 0.08%), respectively. CONCLUSIONS: In cross-border areas of Côte d’Ivoire, LF infection indices in humans and mosquito vectors substantially declined after four rounds of MDA. CFA prevalence fell under the World Health Organization (WHO)-established threshold (1%) in Aboisso, Ouangolodougou and Odienné. Moreover, W. bancrofti prevalence in mosquitoes was lower than WHO-established threshold (2%) in all areas. This might suggest the interruption of W. bancrofti transmission, and possible MDA cessation. However, a formal transmission assessment survey (TAS) and molecular xenomonitoring in mosquito vectors should be implemented before eventual MDA cessation. However, MDA should pursue in Bloléquin where W. bancrofti infection prevalence remained above 1%. Our results provided important ramifications for LF control efforts towards EPHP in Côte d’Ivoire.
format Online
Article
Text
id pubmed-7153895
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-71538952020-04-16 Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa Yokoly, Firmain N. Zahouli, Julien B. Z. Méite, Aboulaye Opoku, Millicent Kouassi, Bernard L. de Souza, Dziedzom K. Bockarie, Moses Koudou, Benjamin G. PLoS One Research Article BACKGROUND: Lymphatic filariasis (LF) is widely endemic in Côte d’Ivoire, and elimination as public health problem (EPHP) is based on annual mass drug administration (MDA) using ivermectin and albendazole. To guide EPHP efforts, we evaluated Wuchereria bancrofti infection indices among humans, and mosquito vectors after four rounds of MDA in four cross-border health districts of Côte d’Ivoire. METHODOLOGY: We monitored people and mosquitoes for W. bancrofti infections in the cross-border health districts of Aboisso, Bloléquin, Odienné and Ouangolodougou, Côte d’Ivoire. W. bancrofti circulating filarial antigen (CFA) was identified using filariasis test strips, and antigen-positive individuals were screened for microfilaremia. Moreover, filarial mosquito vectors were sampled using window exit traps and pyrethrum sprays, and identified morphologically at species level. Anopheles gambiae s.l. and Culex quinquefasciatus females were analyzed for W. bancrofti infection using polymerase chain reaction (PCR) technique. PRINCIPAL FINDINGS: Overall, we found a substantial decline in W. bancrofti infection indices after four rounds of MDA compared to pre-MDA baseline data. CFA prevalence fell from 3.38–5.50% during pre-MDA to 0.00–1.53% after MDA interventions. No subjects had detectable levels of CFA in Ouangolodougou. Moreover, post-MDA CFA prevalence was very low, and below the 1% elimination threshold in Aboisso (0.19%) and Odienné (0.49%). Conversely, CFA prevalence remained above 1% in Bloléquin (1.53%). W. bancrofti microfilariae (Mf) were not found in Aboisso, Bloléquin, and Ouangolodougou, except for Odienné with low prevalence (0.16%; n = 613) and microfilaremia of 32.0 Mf/mL. No An. gambiae s.l. and Cx. quinquefasciatus pools were infected with W. bancrofti in Bloléquin and Ouangolodougou, while they exhibited low infection rates in Aboisso (1% and 0.07%), and Odienné (0.08% and 0.08%), respectively. CONCLUSIONS: In cross-border areas of Côte d’Ivoire, LF infection indices in humans and mosquito vectors substantially declined after four rounds of MDA. CFA prevalence fell under the World Health Organization (WHO)-established threshold (1%) in Aboisso, Ouangolodougou and Odienné. Moreover, W. bancrofti prevalence in mosquitoes was lower than WHO-established threshold (2%) in all areas. This might suggest the interruption of W. bancrofti transmission, and possible MDA cessation. However, a formal transmission assessment survey (TAS) and molecular xenomonitoring in mosquito vectors should be implemented before eventual MDA cessation. However, MDA should pursue in Bloléquin where W. bancrofti infection prevalence remained above 1%. Our results provided important ramifications for LF control efforts towards EPHP in Côte d’Ivoire. Public Library of Science 2020-04-13 /pmc/articles/PMC7153895/ /pubmed/32282840 http://dx.doi.org/10.1371/journal.pone.0231541 Text en © 2020 Yokoly et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Yokoly, Firmain N.
Zahouli, Julien B. Z.
Méite, Aboulaye
Opoku, Millicent
Kouassi, Bernard L.
de Souza, Dziedzom K.
Bockarie, Moses
Koudou, Benjamin G.
Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title_full Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title_fullStr Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title_full_unstemmed Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title_short Low transmission of Wuchereria bancrofti in cross-border districts of Côte d’Ivoire: A great step towards lymphatic filariasis elimination in West Africa
title_sort low transmission of wuchereria bancrofti in cross-border districts of côte d’ivoire: a great step towards lymphatic filariasis elimination in west africa
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7153895/
https://www.ncbi.nlm.nih.gov/pubmed/32282840
http://dx.doi.org/10.1371/journal.pone.0231541
work_keys_str_mv AT yokolyfirmainn lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT zahoulijulienbz lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT meiteaboulaye lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT opokumillicent lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT kouassibernardl lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT desouzadziedzomk lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT bockariemoses lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica
AT koudoubenjaming lowtransmissionofwuchereriabancroftiincrossborderdistrictsofcotedivoireagreatsteptowardslymphaticfilariasiseliminationinwestafrica