Cargando…

SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer

SPL (SQUAMOSA promoter binding protein-like) gene family is specific transcription factor in the plant that have an important function for plant growth and development. Although the SPL gene family has been widely studied and reported in many various plant species from gymnosperm to angiosperm, ther...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Shaokun, Li, Li, Jiang, Yang, Wu, Jun, Sun, Honghua, Zhao, Mingzhu, Jiang, Yue, Zhu, Lei, Wang, Yanfang, Su, Yingjie, Wang, Kangyu, Wang, Yi, Zhang, Meiping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7154844/
https://www.ncbi.nlm.nih.gov/pubmed/32168804
http://dx.doi.org/10.3390/plants9030354
_version_ 1783521908210270208
author Li, Shaokun
Li, Li
Jiang, Yang
Wu, Jun
Sun, Honghua
Zhao, Mingzhu
Jiang, Yue
Zhu, Lei
Wang, Yanfang
Su, Yingjie
Wang, Kangyu
Wang, Yi
Zhang, Meiping
author_facet Li, Shaokun
Li, Li
Jiang, Yang
Wu, Jun
Sun, Honghua
Zhao, Mingzhu
Jiang, Yue
Zhu, Lei
Wang, Yanfang
Su, Yingjie
Wang, Kangyu
Wang, Yi
Zhang, Meiping
author_sort Li, Shaokun
collection PubMed
description SPL (SQUAMOSA promoter binding protein-like) gene family is specific transcription factor in the plant that have an important function for plant growth and development. Although the SPL gene family has been widely studied and reported in many various plant species from gymnosperm to angiosperm, there are no systematic studies and reports about the SPL gene family in Panax ginseng C. A. Meyer. In this study, we conducted transcriptome-wide identification, evolutionary analysis, structure analysis, and expression characteristics analysis of SPL gene family in Panax ginseng by bioinformatics. We annotated the PgSPL gene family and found that they might involve in multiple functions including encoding structural proteins, but the main function were still focused on the binding function. The result showed that 106 PgSPL transcripts were classified into two clades - A and B, both of which respectively consisted of three groups. Besides, we profiled PgSPL transcripts’ genotypic, temporal, and spatial expression characteristics. Furthermore, we calculated the correlation of PgSPL transcripts in the 14 tissues of a 4 years old ginseng and 42 farmers’ cultivars farmers’ cultivars of 4 years old ginsengs’ roots with both results showing that SPL transcripts formed a single network, which indicated that PgSPLs inter-coordinated when performing their functions. What’s more, we found that most PgSPL transcripts tended to express in older ginseng instead of younger ginseng, which was not only reflected in the expression of more types of SPL transcripts in older ginseng, but also in the higher expression of SPL transcripts in older ginseng. Additionally, we found that four PgSPL transcripts were only massively expressed in roots. According to PgSPL transcripts’ expression characteristics, we found that PgSPL23-35 and PgSPL24-09 were most proper two transcripts to further study as ginseng age’s molecular marker. These results provide the basis for further elucidation of the PgSPL transcripts’ biological function in ginseng and ginseng genetics improvement and gene breeding in the future.
format Online
Article
Text
id pubmed-7154844
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-71548442020-04-21 SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer Li, Shaokun Li, Li Jiang, Yang Wu, Jun Sun, Honghua Zhao, Mingzhu Jiang, Yue Zhu, Lei Wang, Yanfang Su, Yingjie Wang, Kangyu Wang, Yi Zhang, Meiping Plants (Basel) Article SPL (SQUAMOSA promoter binding protein-like) gene family is specific transcription factor in the plant that have an important function for plant growth and development. Although the SPL gene family has been widely studied and reported in many various plant species from gymnosperm to angiosperm, there are no systematic studies and reports about the SPL gene family in Panax ginseng C. A. Meyer. In this study, we conducted transcriptome-wide identification, evolutionary analysis, structure analysis, and expression characteristics analysis of SPL gene family in Panax ginseng by bioinformatics. We annotated the PgSPL gene family and found that they might involve in multiple functions including encoding structural proteins, but the main function were still focused on the binding function. The result showed that 106 PgSPL transcripts were classified into two clades - A and B, both of which respectively consisted of three groups. Besides, we profiled PgSPL transcripts’ genotypic, temporal, and spatial expression characteristics. Furthermore, we calculated the correlation of PgSPL transcripts in the 14 tissues of a 4 years old ginseng and 42 farmers’ cultivars farmers’ cultivars of 4 years old ginsengs’ roots with both results showing that SPL transcripts formed a single network, which indicated that PgSPLs inter-coordinated when performing their functions. What’s more, we found that most PgSPL transcripts tended to express in older ginseng instead of younger ginseng, which was not only reflected in the expression of more types of SPL transcripts in older ginseng, but also in the higher expression of SPL transcripts in older ginseng. Additionally, we found that four PgSPL transcripts were only massively expressed in roots. According to PgSPL transcripts’ expression characteristics, we found that PgSPL23-35 and PgSPL24-09 were most proper two transcripts to further study as ginseng age’s molecular marker. These results provide the basis for further elucidation of the PgSPL transcripts’ biological function in ginseng and ginseng genetics improvement and gene breeding in the future. MDPI 2020-03-11 /pmc/articles/PMC7154844/ /pubmed/32168804 http://dx.doi.org/10.3390/plants9030354 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Li, Shaokun
Li, Li
Jiang, Yang
Wu, Jun
Sun, Honghua
Zhao, Mingzhu
Jiang, Yue
Zhu, Lei
Wang, Yanfang
Su, Yingjie
Wang, Kangyu
Wang, Yi
Zhang, Meiping
SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title_full SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title_fullStr SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title_full_unstemmed SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title_short SQUAMOSA Promoter Binding Protein-Like (SPL) Gene Family: TRANSCRIPTOME-Wide Identification, Phylogenetic Relationship, Expression Patterns and Network Interaction Analysis in Panax ginseng C. A. Meyer
title_sort squamosa promoter binding protein-like (spl) gene family: transcriptome-wide identification, phylogenetic relationship, expression patterns and network interaction analysis in panax ginseng c. a. meyer
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7154844/
https://www.ncbi.nlm.nih.gov/pubmed/32168804
http://dx.doi.org/10.3390/plants9030354
work_keys_str_mv AT lishaokun squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT lili squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT jiangyang squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT wujun squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT sunhonghua squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT zhaomingzhu squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT jiangyue squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT zhulei squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT wangyanfang squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT suyingjie squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT wangkangyu squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT wangyi squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer
AT zhangmeiping squamosapromoterbindingproteinlikesplgenefamilytranscriptomewideidentificationphylogeneticrelationshipexpressionpatternsandnetworkinteractionanalysisinpanaxginsengcameyer