Cargando…
Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas
BACKGROUND: By expanding primary health care services, Ethiopia has reduced under-five mor4tality. Utilisation of these services is still low, and concerted efforts are needed for continued improvements in newborn and child survival. “Optimizing the Health Extension Program” is a complex interventio...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7171736/ https://www.ncbi.nlm.nih.gov/pubmed/32316969 http://dx.doi.org/10.1186/s12913-020-05151-3 |
_version_ | 1783524125124329472 |
---|---|
author | Berhanu, Della Okwaraji, Yemisrach B. Belayneh, Abebe Bekele Lemango, Ephrem Tekle Agonafer, Nesibu Birhanu, Bizuhan Gelaw Abera, Kurabachew Betemariam, Wuleta Medhanyie, Araya Abrha Abera, Muluemebet Yitayal, Mezgebu Belay, Fitsum Woldegebriel Persson, Lars Åke Schellenberg, Joanna |
author_facet | Berhanu, Della Okwaraji, Yemisrach B. Belayneh, Abebe Bekele Lemango, Ephrem Tekle Agonafer, Nesibu Birhanu, Bizuhan Gelaw Abera, Kurabachew Betemariam, Wuleta Medhanyie, Araya Abrha Abera, Muluemebet Yitayal, Mezgebu Belay, Fitsum Woldegebriel Persson, Lars Åke Schellenberg, Joanna |
author_sort | Berhanu, Della |
collection | PubMed |
description | BACKGROUND: By expanding primary health care services, Ethiopia has reduced under-five mor4tality. Utilisation of these services is still low, and concerted efforts are needed for continued improvements in newborn and child survival. “Optimizing the Health Extension Program” is a complex intervention based on a logic framework developed from an analysis of barriers to the utilisation of primary child health services. This intervention includes innovative components to engage the community, strengthen the capacity of primary health care workers, and reinforce the local ownership and accountability of the primary child health services. This paper presents a protocol for the process and outcome evaluation, using a pragmatic trial design including before-and-after assessments in both intervention and comparison areas across four Ethiopian regions. The study has an integrated research capacity building initiative, including ten Ph.D. students recruited from Ethiopian Regional Health Bureaus and universities. METHODS: Baseline and endline surveys 2 years apart include household, facility, health worker, and district health office modules in intervention and comparison areas across Amhara, Southern Nations Nationalities and Peoples, Oromia, and Tigray regions. The effectiveness of the intervention on the seeking and receiving of appropriate care will be estimated by difference-in-differences analysis, adjusting for clustering and for relevant confounders. The process evaluation follows the guidelines of the UK Medical Research Council. The implementation is monitored using data that we anticipate will be used to describe the fidelity, reach, dose, contextual factors and cost. The participating Ph.D. students plan to perform in-depth analyses on different topics including equity, referral, newborn care practices, quality-of-care, geographic differences, and other process evaluation components. DISCUSSION: This protocol describes an evaluation of a complex intervention that aims at increased utilisation of primary and child health services. This unique collaborative effort includes key stakeholders from the Ethiopian health system, the implementing non-governmental organisations and universities, and combines state-of-the art effectiveness estimates and process evaluation with capacity building. The lessons learned from the project will inform efforts to engage communities and increase utilisation of care for children in other parts of Ethiopia and beyond. TRIAL REGISTRATION: Current Controlled Trials ISRCTN12040912, retrospectively registered on 19 December, 2017. |
format | Online Article Text |
id | pubmed-7171736 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-71717362020-04-24 Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas Berhanu, Della Okwaraji, Yemisrach B. Belayneh, Abebe Bekele Lemango, Ephrem Tekle Agonafer, Nesibu Birhanu, Bizuhan Gelaw Abera, Kurabachew Betemariam, Wuleta Medhanyie, Araya Abrha Abera, Muluemebet Yitayal, Mezgebu Belay, Fitsum Woldegebriel Persson, Lars Åke Schellenberg, Joanna BMC Health Serv Res Study Protocol BACKGROUND: By expanding primary health care services, Ethiopia has reduced under-five mor4tality. Utilisation of these services is still low, and concerted efforts are needed for continued improvements in newborn and child survival. “Optimizing the Health Extension Program” is a complex intervention based on a logic framework developed from an analysis of barriers to the utilisation of primary child health services. This intervention includes innovative components to engage the community, strengthen the capacity of primary health care workers, and reinforce the local ownership and accountability of the primary child health services. This paper presents a protocol for the process and outcome evaluation, using a pragmatic trial design including before-and-after assessments in both intervention and comparison areas across four Ethiopian regions. The study has an integrated research capacity building initiative, including ten Ph.D. students recruited from Ethiopian Regional Health Bureaus and universities. METHODS: Baseline and endline surveys 2 years apart include household, facility, health worker, and district health office modules in intervention and comparison areas across Amhara, Southern Nations Nationalities and Peoples, Oromia, and Tigray regions. The effectiveness of the intervention on the seeking and receiving of appropriate care will be estimated by difference-in-differences analysis, adjusting for clustering and for relevant confounders. The process evaluation follows the guidelines of the UK Medical Research Council. The implementation is monitored using data that we anticipate will be used to describe the fidelity, reach, dose, contextual factors and cost. The participating Ph.D. students plan to perform in-depth analyses on different topics including equity, referral, newborn care practices, quality-of-care, geographic differences, and other process evaluation components. DISCUSSION: This protocol describes an evaluation of a complex intervention that aims at increased utilisation of primary and child health services. This unique collaborative effort includes key stakeholders from the Ethiopian health system, the implementing non-governmental organisations and universities, and combines state-of-the art effectiveness estimates and process evaluation with capacity building. The lessons learned from the project will inform efforts to engage communities and increase utilisation of care for children in other parts of Ethiopia and beyond. TRIAL REGISTRATION: Current Controlled Trials ISRCTN12040912, retrospectively registered on 19 December, 2017. BioMed Central 2020-04-21 /pmc/articles/PMC7171736/ /pubmed/32316969 http://dx.doi.org/10.1186/s12913-020-05151-3 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Study Protocol Berhanu, Della Okwaraji, Yemisrach B. Belayneh, Abebe Bekele Lemango, Ephrem Tekle Agonafer, Nesibu Birhanu, Bizuhan Gelaw Abera, Kurabachew Betemariam, Wuleta Medhanyie, Araya Abrha Abera, Muluemebet Yitayal, Mezgebu Belay, Fitsum Woldegebriel Persson, Lars Åke Schellenberg, Joanna Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title | Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title_full | Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title_fullStr | Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title_full_unstemmed | Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title_short | Protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in Ethiopia: a before and after study in intervention and comparison areas |
title_sort | protocol for the evaluation of a complex intervention aiming at increased utilisation of primary child health services in ethiopia: a before and after study in intervention and comparison areas |
topic | Study Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7171736/ https://www.ncbi.nlm.nih.gov/pubmed/32316969 http://dx.doi.org/10.1186/s12913-020-05151-3 |
work_keys_str_mv | AT berhanudella protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT okwarajiyemisrachb protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT belaynehabebebekele protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT lemangoephremtekle protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT agonafernesibu protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT birhanubizuhangelaw protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT aberakurabachew protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT betemariamwuleta protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT medhanyiearayaabrha protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT aberamuluemebet protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT yitayalmezgebu protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT belayfitsumwoldegebriel protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT perssonlarsake protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas AT schellenbergjoanna protocolfortheevaluationofacomplexinterventionaimingatincreasedutilisationofprimarychildhealthservicesinethiopiaabeforeandafterstudyininterventionandcomparisonareas |