Cargando…
MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR
Objective: The current study aimed to investigate the functional roles and clinical significance of microRNA-148a (miR-148a) in the progression of oral squamous cell carcinoma (OSCC). Methods: Relative expression of miR-148a in OSCC cells and tissues were detected using quantitative real-time polyme...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Portland Press Ltd.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7174276/ https://www.ncbi.nlm.nih.gov/pubmed/32202300 http://dx.doi.org/10.1042/BSR20182458 |
_version_ | 1783524603668201472 |
---|---|
author | Jia, Tingting Ren, Yipeng Wang, Fengze Zhao, Rui Qiao, Bo Xing, Lejun Ou, Long Guo, Bin |
author_facet | Jia, Tingting Ren, Yipeng Wang, Fengze Zhao, Rui Qiao, Bo Xing, Lejun Ou, Long Guo, Bin |
author_sort | Jia, Tingting |
collection | PubMed |
description | Objective: The current study aimed to investigate the functional roles and clinical significance of microRNA-148a (miR-148a) in the progression of oral squamous cell carcinoma (OSCC). Methods: Relative expression of miR-148a in OSCC cells and tissues were detected using quantitative real-time polymerase chain reaction (qRT-PCR). Chi-square test was performed to estimate the relationship between miR-148a expression and clinical characteristics of OSCC patients. Cell transfection was carried out using Lipofectamine® 2000. Biological behaviors of tumor cells were detected using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and transwell assays. Bioinformatics analysis and luciferase reporter assay were used to identify the target genes of miR-148a. Protein expression was detected through Western blot analysis. Results: MiR-148a expression was obviously decreased in OSCC tissues and cells, and such down-regulation was closely correlated with lymph node metastasis (P=0.027) and tumor node metastasis (TNM) stage (P=0.001) of OSCC patients. miR-148a overexpression could significantly impair OSCC cell proliferation, migration and invasion in vitro (P<0.05 for all). Insulin-like growth factor-I receptor (IGF-IR) was a potential target of miR-148a. MiR-148a could inhibit ERK/MAPK signaling pathway through targeting IGF-IR. Conclusion: MiR-148a plays an anti-tumor role in OSCC and inhibits OSCC progression through suppressing ERK/MAPK pathway via targeting IGF-IR. |
format | Online Article Text |
id | pubmed-7174276 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Portland Press Ltd. |
record_format | MEDLINE/PubMed |
spelling | pubmed-71742762020-04-23 MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR Jia, Tingting Ren, Yipeng Wang, Fengze Zhao, Rui Qiao, Bo Xing, Lejun Ou, Long Guo, Bin Biosci Rep Cancer Objective: The current study aimed to investigate the functional roles and clinical significance of microRNA-148a (miR-148a) in the progression of oral squamous cell carcinoma (OSCC). Methods: Relative expression of miR-148a in OSCC cells and tissues were detected using quantitative real-time polymerase chain reaction (qRT-PCR). Chi-square test was performed to estimate the relationship between miR-148a expression and clinical characteristics of OSCC patients. Cell transfection was carried out using Lipofectamine® 2000. Biological behaviors of tumor cells were detected using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and transwell assays. Bioinformatics analysis and luciferase reporter assay were used to identify the target genes of miR-148a. Protein expression was detected through Western blot analysis. Results: MiR-148a expression was obviously decreased in OSCC tissues and cells, and such down-regulation was closely correlated with lymph node metastasis (P=0.027) and tumor node metastasis (TNM) stage (P=0.001) of OSCC patients. miR-148a overexpression could significantly impair OSCC cell proliferation, migration and invasion in vitro (P<0.05 for all). Insulin-like growth factor-I receptor (IGF-IR) was a potential target of miR-148a. MiR-148a could inhibit ERK/MAPK signaling pathway through targeting IGF-IR. Conclusion: MiR-148a plays an anti-tumor role in OSCC and inhibits OSCC progression through suppressing ERK/MAPK pathway via targeting IGF-IR. Portland Press Ltd. 2020-04-21 /pmc/articles/PMC7174276/ /pubmed/32202300 http://dx.doi.org/10.1042/BSR20182458 Text en © 2020 The Author(s). https://creativecommons.org/licenses/by/4.0/ This is an open access article published by Portland Press Limited on behalf of the Biochemical Society and distributed under the Creative Commons Attribution License 4.0 (CC BY). |
spellingShingle | Cancer Jia, Tingting Ren, Yipeng Wang, Fengze Zhao, Rui Qiao, Bo Xing, Lejun Ou, Long Guo, Bin MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title | MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title_full | MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title_fullStr | MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title_full_unstemmed | MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title_short | MiR-148a inhibits oral squamous cell carcinoma progression through ERK/MAPK pathway via targeting IGF-IR |
title_sort | mir-148a inhibits oral squamous cell carcinoma progression through erk/mapk pathway via targeting igf-ir |
topic | Cancer |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7174276/ https://www.ncbi.nlm.nih.gov/pubmed/32202300 http://dx.doi.org/10.1042/BSR20182458 |
work_keys_str_mv | AT jiatingting mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT renyipeng mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT wangfengze mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT zhaorui mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT qiaobo mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT xinglejun mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT oulong mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir AT guobin mir148ainhibitsoralsquamouscellcarcinomaprogressionthrougherkmapkpathwayviatargetingigfir |