Cargando…

Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review

Background  Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative ther...

Descripción completa

Detalles Bibliográficos
Autores principales: Forte, Antonio J., Khan, Nawal, Huayllani, Maria T., Boczar, Daniel, Saleem, Humza Y., Lu, Xiaona, Manrique, Oscar J., Ciudad, Pedro, McLaughlin, Sarah A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Thieme Medical and Scientific Publishers Private Ltd. 2020
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7192660/
https://www.ncbi.nlm.nih.gov/pubmed/32367914
http://dx.doi.org/10.1055/s-0040-1709372
_version_ 1783528048824418304
author Forte, Antonio J.
Khan, Nawal
Huayllani, Maria T.
Boczar, Daniel
Saleem, Humza Y.
Lu, Xiaona
Manrique, Oscar J.
Ciudad, Pedro
McLaughlin, Sarah A.
author_facet Forte, Antonio J.
Khan, Nawal
Huayllani, Maria T.
Boczar, Daniel
Saleem, Humza Y.
Lu, Xiaona
Manrique, Oscar J.
Ciudad, Pedro
McLaughlin, Sarah A.
author_sort Forte, Antonio J.
collection PubMed
description Background  Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative therapies are the first step in treatment of LEL; however, they do not provide a cure because they fail to address the underlying physiologic dysfunction of the lymphatic system. Among several surgical alternatives, lymphaticovenous anastomosis (LVA) has gained popularity due to its improved outcomes and less invasive approach. This study aims to review the published literature on LVA for LEL treatment and to analyze the surgical outcomes. Methods  PubMed database was used to perform a comprehensive literature review of all articles describing LVA for treatment of LEL from Novemeber 1985 to June 2019. Search terms included “lymphovenous” OR “lymphaticovenous” AND “bypass” OR “anastomosis” OR “shunt” AND “lower extremity lymphedema.” Results  A total of 95 articles were identified in the initial query, out of which 58 individual articles were deemed eligible. The studies included in this review describe notable variations in surgical techniques, number of anastomoses, and supplementary interventions. All, except one study, reported positive outcomes based on limb circumference and volume changes or subjective clinical improvement. The largest reduction rate in limb circumference and volume was 63.8%. Conclusion  LVA demonstrated a considerable reduction in limb volume and improvement in subjective findings of lymphedema in the majority of patients. The maintained effectiveness of this treatment modality in long-term follow-up suggests great efficacy of LVA in LEL treatment.
format Online
Article
Text
id pubmed-7192660
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Thieme Medical and Scientific Publishers Private Ltd.
record_format MEDLINE/PubMed
spelling pubmed-71926602020-05-04 Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review Forte, Antonio J. Khan, Nawal Huayllani, Maria T. Boczar, Daniel Saleem, Humza Y. Lu, Xiaona Manrique, Oscar J. Ciudad, Pedro McLaughlin, Sarah A. Indian J Plast Surg Background  Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative therapies are the first step in treatment of LEL; however, they do not provide a cure because they fail to address the underlying physiologic dysfunction of the lymphatic system. Among several surgical alternatives, lymphaticovenous anastomosis (LVA) has gained popularity due to its improved outcomes and less invasive approach. This study aims to review the published literature on LVA for LEL treatment and to analyze the surgical outcomes. Methods  PubMed database was used to perform a comprehensive literature review of all articles describing LVA for treatment of LEL from Novemeber 1985 to June 2019. Search terms included “lymphovenous” OR “lymphaticovenous” AND “bypass” OR “anastomosis” OR “shunt” AND “lower extremity lymphedema.” Results  A total of 95 articles were identified in the initial query, out of which 58 individual articles were deemed eligible. The studies included in this review describe notable variations in surgical techniques, number of anastomoses, and supplementary interventions. All, except one study, reported positive outcomes based on limb circumference and volume changes or subjective clinical improvement. The largest reduction rate in limb circumference and volume was 63.8%. Conclusion  LVA demonstrated a considerable reduction in limb volume and improvement in subjective findings of lymphedema in the majority of patients. The maintained effectiveness of this treatment modality in long-term follow-up suggests great efficacy of LVA in LEL treatment. Thieme Medical and Scientific Publishers Private Ltd. 2020-03 2020-04-17 /pmc/articles/PMC7192660/ /pubmed/32367914 http://dx.doi.org/10.1055/s-0040-1709372 Text en https://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivatives License, which permits unrestricted reproduction and distribution, for non-commercial purposes only; and use and reproduction, but not distribution, of adapted material for non-commercial purposes only, provided the original work is properly cited.
spellingShingle Forte, Antonio J.
Khan, Nawal
Huayllani, Maria T.
Boczar, Daniel
Saleem, Humza Y.
Lu, Xiaona
Manrique, Oscar J.
Ciudad, Pedro
McLaughlin, Sarah A.
Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title_full Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title_fullStr Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title_full_unstemmed Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title_short Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
title_sort lymphaticovenous anastomosis for lower extremity lymphedema: a systematic review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7192660/
https://www.ncbi.nlm.nih.gov/pubmed/32367914
http://dx.doi.org/10.1055/s-0040-1709372
work_keys_str_mv AT forteantonioj lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT khannawal lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT huayllanimariat lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT boczardaniel lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT saleemhumzay lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT luxiaona lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT manriqueoscarj lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT ciudadpedro lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview
AT mclaughlinsaraha lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview