Cargando…
Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review
Background Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative ther...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Thieme Medical and Scientific Publishers Private Ltd.
2020
|
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7192660/ https://www.ncbi.nlm.nih.gov/pubmed/32367914 http://dx.doi.org/10.1055/s-0040-1709372 |
_version_ | 1783528048824418304 |
---|---|
author | Forte, Antonio J. Khan, Nawal Huayllani, Maria T. Boczar, Daniel Saleem, Humza Y. Lu, Xiaona Manrique, Oscar J. Ciudad, Pedro McLaughlin, Sarah A. |
author_facet | Forte, Antonio J. Khan, Nawal Huayllani, Maria T. Boczar, Daniel Saleem, Humza Y. Lu, Xiaona Manrique, Oscar J. Ciudad, Pedro McLaughlin, Sarah A. |
author_sort | Forte, Antonio J. |
collection | PubMed |
description | Background Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative therapies are the first step in treatment of LEL; however, they do not provide a cure because they fail to address the underlying physiologic dysfunction of the lymphatic system. Among several surgical alternatives, lymphaticovenous anastomosis (LVA) has gained popularity due to its improved outcomes and less invasive approach. This study aims to review the published literature on LVA for LEL treatment and to analyze the surgical outcomes. Methods PubMed database was used to perform a comprehensive literature review of all articles describing LVA for treatment of LEL from Novemeber 1985 to June 2019. Search terms included “lymphovenous” OR “lymphaticovenous” AND “bypass” OR “anastomosis” OR “shunt” AND “lower extremity lymphedema.” Results A total of 95 articles were identified in the initial query, out of which 58 individual articles were deemed eligible. The studies included in this review describe notable variations in surgical techniques, number of anastomoses, and supplementary interventions. All, except one study, reported positive outcomes based on limb circumference and volume changes or subjective clinical improvement. The largest reduction rate in limb circumference and volume was 63.8%. Conclusion LVA demonstrated a considerable reduction in limb volume and improvement in subjective findings of lymphedema in the majority of patients. The maintained effectiveness of this treatment modality in long-term follow-up suggests great efficacy of LVA in LEL treatment. |
format | Online Article Text |
id | pubmed-7192660 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Thieme Medical and Scientific Publishers Private Ltd. |
record_format | MEDLINE/PubMed |
spelling | pubmed-71926602020-05-04 Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review Forte, Antonio J. Khan, Nawal Huayllani, Maria T. Boczar, Daniel Saleem, Humza Y. Lu, Xiaona Manrique, Oscar J. Ciudad, Pedro McLaughlin, Sarah A. Indian J Plast Surg Background Lymphedema is an accumulation of protein-rich fluid in the interstitial spaces resulting from impairment in the lymphatic circulation that can impair quality of life and cause considerable morbidity. Lower extremity lymphedema (LEL) has an overall incidence rate of 20%. Conservative therapies are the first step in treatment of LEL; however, they do not provide a cure because they fail to address the underlying physiologic dysfunction of the lymphatic system. Among several surgical alternatives, lymphaticovenous anastomosis (LVA) has gained popularity due to its improved outcomes and less invasive approach. This study aims to review the published literature on LVA for LEL treatment and to analyze the surgical outcomes. Methods PubMed database was used to perform a comprehensive literature review of all articles describing LVA for treatment of LEL from Novemeber 1985 to June 2019. Search terms included “lymphovenous” OR “lymphaticovenous” AND “bypass” OR “anastomosis” OR “shunt” AND “lower extremity lymphedema.” Results A total of 95 articles were identified in the initial query, out of which 58 individual articles were deemed eligible. The studies included in this review describe notable variations in surgical techniques, number of anastomoses, and supplementary interventions. All, except one study, reported positive outcomes based on limb circumference and volume changes or subjective clinical improvement. The largest reduction rate in limb circumference and volume was 63.8%. Conclusion LVA demonstrated a considerable reduction in limb volume and improvement in subjective findings of lymphedema in the majority of patients. The maintained effectiveness of this treatment modality in long-term follow-up suggests great efficacy of LVA in LEL treatment. Thieme Medical and Scientific Publishers Private Ltd. 2020-03 2020-04-17 /pmc/articles/PMC7192660/ /pubmed/32367914 http://dx.doi.org/10.1055/s-0040-1709372 Text en https://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivatives License, which permits unrestricted reproduction and distribution, for non-commercial purposes only; and use and reproduction, but not distribution, of adapted material for non-commercial purposes only, provided the original work is properly cited. |
spellingShingle | Forte, Antonio J. Khan, Nawal Huayllani, Maria T. Boczar, Daniel Saleem, Humza Y. Lu, Xiaona Manrique, Oscar J. Ciudad, Pedro McLaughlin, Sarah A. Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title | Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title_full | Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title_fullStr | Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title_full_unstemmed | Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title_short | Lymphaticovenous Anastomosis for Lower Extremity Lymphedema: A Systematic Review |
title_sort | lymphaticovenous anastomosis for lower extremity lymphedema: a systematic review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7192660/ https://www.ncbi.nlm.nih.gov/pubmed/32367914 http://dx.doi.org/10.1055/s-0040-1709372 |
work_keys_str_mv | AT forteantonioj lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT khannawal lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT huayllanimariat lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT boczardaniel lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT saleemhumzay lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT luxiaona lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT manriqueoscarj lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT ciudadpedro lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview AT mclaughlinsaraha lymphaticovenousanastomosisforlowerextremitylymphedemaasystematicreview |