Cargando…

Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review

BACKGROUND: In recent years, more than 120 million people each year have needed urgent humanitarian assistance and protection. Armed conflict has profoundly negative consequences in communities. Destruction of civilian infrastructure impacts access to basic health services and complicates widespread...

Descripción completa

Detalles Bibliográficos
Autores principales: Jain, Reena P, Meteke, Sarah, Gaffey, Michelle F, Kamali, Mahdis, Munyuzangabo, Mariella, Als, Daina, Shah, Shailja, Siddiqui, Fahad J, Radhakrishnan, Amruta, Ataullahjan, Anushka, Bhutta, Zulfiqar A
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BMJ Publishing Group 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7204922/
https://www.ncbi.nlm.nih.gov/pubmed/32399262
http://dx.doi.org/10.1136/bmjgh-2019-001980
_version_ 1783530147550330880
author Jain, Reena P
Meteke, Sarah
Gaffey, Michelle F
Kamali, Mahdis
Munyuzangabo, Mariella
Als, Daina
Shah, Shailja
Siddiqui, Fahad J
Radhakrishnan, Amruta
Ataullahjan, Anushka
Bhutta, Zulfiqar A
author_facet Jain, Reena P
Meteke, Sarah
Gaffey, Michelle F
Kamali, Mahdis
Munyuzangabo, Mariella
Als, Daina
Shah, Shailja
Siddiqui, Fahad J
Radhakrishnan, Amruta
Ataullahjan, Anushka
Bhutta, Zulfiqar A
author_sort Jain, Reena P
collection PubMed
description BACKGROUND: In recent years, more than 120 million people each year have needed urgent humanitarian assistance and protection. Armed conflict has profoundly negative consequences in communities. Destruction of civilian infrastructure impacts access to basic health services and complicates widespread emergency responses. The number of conflicts occurring is increasing, lasting longer and affecting more people today than a decade ago. The number of children living in conflict zones has been steadily increasing since the year 2000, increasing the need for health services and resources. This review systematically synthesised the indexed and grey literature reporting on the delivery of trauma and rehabilitation interventions for conflict-affected populations. METHODS: A systematic search of literature published from 1 January 1990 to 31 March 2018 was conducted across several databases. Eligible publications reported on women and children in low and middle-income countries. Included publications provided information on the delivery of interventions for trauma, sustained injuries or rehabilitation in conflict-affected populations. RESULTS: A total of 81 publications met the inclusion criteria, and were included in our review. Nearly all of the included publications were observational in nature, employing retrospective chart reviews of surgical procedures delivered in a hospital setting to conflict-affected individuals. The majority of publications reported injuries due to explosive devices and remnants of war. Injuries requiring orthopaedic/reconstructive surgeries were the most commonly reported interventions. Barriers to health services centred on the distance and availability from the site of injury to health facilities. CONCLUSIONS: Traumatic injuries require an array of medical and surgical interventions, and their effective treatment largely depends on prompt and timely management and referral, with appropriate rehabilitation services and post-treatment follow-up. Further work to evaluate intervention delivery in this domain is needed, particularly among children given their specialised needs, and in different population displacement contexts. PROSPERO REGISTRATION NUMBER: CRD42019125221.
format Online
Article
Text
id pubmed-7204922
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BMJ Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-72049222020-05-12 Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review Jain, Reena P Meteke, Sarah Gaffey, Michelle F Kamali, Mahdis Munyuzangabo, Mariella Als, Daina Shah, Shailja Siddiqui, Fahad J Radhakrishnan, Amruta Ataullahjan, Anushka Bhutta, Zulfiqar A BMJ Glob Health Original Research BACKGROUND: In recent years, more than 120 million people each year have needed urgent humanitarian assistance and protection. Armed conflict has profoundly negative consequences in communities. Destruction of civilian infrastructure impacts access to basic health services and complicates widespread emergency responses. The number of conflicts occurring is increasing, lasting longer and affecting more people today than a decade ago. The number of children living in conflict zones has been steadily increasing since the year 2000, increasing the need for health services and resources. This review systematically synthesised the indexed and grey literature reporting on the delivery of trauma and rehabilitation interventions for conflict-affected populations. METHODS: A systematic search of literature published from 1 January 1990 to 31 March 2018 was conducted across several databases. Eligible publications reported on women and children in low and middle-income countries. Included publications provided information on the delivery of interventions for trauma, sustained injuries or rehabilitation in conflict-affected populations. RESULTS: A total of 81 publications met the inclusion criteria, and were included in our review. Nearly all of the included publications were observational in nature, employing retrospective chart reviews of surgical procedures delivered in a hospital setting to conflict-affected individuals. The majority of publications reported injuries due to explosive devices and remnants of war. Injuries requiring orthopaedic/reconstructive surgeries were the most commonly reported interventions. Barriers to health services centred on the distance and availability from the site of injury to health facilities. CONCLUSIONS: Traumatic injuries require an array of medical and surgical interventions, and their effective treatment largely depends on prompt and timely management and referral, with appropriate rehabilitation services and post-treatment follow-up. Further work to evaluate intervention delivery in this domain is needed, particularly among children given their specialised needs, and in different population displacement contexts. PROSPERO REGISTRATION NUMBER: CRD42019125221. BMJ Publishing Group 2020-04-23 /pmc/articles/PMC7204922/ /pubmed/32399262 http://dx.doi.org/10.1136/bmjgh-2019-001980 Text en © Author(s) (or their employer(s)) 2020. Re-use permitted under CC BY. Published by BMJ. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed in accordance with the Creative Commons Attribution 4.0 Unported (CC BY 4.0) license, which permits others to copy, redistribute, remix, transform and build upon this work for any purpose, provided the original work is properly cited, a link to the licence is given, and indication of whether changes were made. See: https://creativecommons.org/licenses/by/4.0/.
spellingShingle Original Research
Jain, Reena P
Meteke, Sarah
Gaffey, Michelle F
Kamali, Mahdis
Munyuzangabo, Mariella
Als, Daina
Shah, Shailja
Siddiqui, Fahad J
Radhakrishnan, Amruta
Ataullahjan, Anushka
Bhutta, Zulfiqar A
Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title_full Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title_fullStr Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title_full_unstemmed Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title_short Delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
title_sort delivering trauma and rehabilitation interventions to women and children in conflict settings: a systematic review
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7204922/
https://www.ncbi.nlm.nih.gov/pubmed/32399262
http://dx.doi.org/10.1136/bmjgh-2019-001980
work_keys_str_mv AT jainreenap deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT metekesarah deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT gaffeymichellef deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT kamalimahdis deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT munyuzangabomariella deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT alsdaina deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT shahshailja deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT siddiquifahadj deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT radhakrishnanamruta deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT ataullahjananushka deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview
AT bhuttazulfiqara deliveringtraumaandrehabilitationinterventionstowomenandchildreninconflictsettingsasystematicreview