Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model
PURPOSE: Accumulating evidence has suggested that toll-like receptor 4 (TLR4) is critically involved in the pathogenesis of asthma. The aim of this study was to investigate the role of TLR4 in toluene diisocyanate (TDI)-induced allergic airway inflammation. METHODS: TLR4(−/−) and wild-type (WT) C57B...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Academy of Asthma, Allergy and Clinical Immunology; The Korean Academy of Pediatric Allergy and Respiratory Disease
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7225000/ https://www.ncbi.nlm.nih.gov/pubmed/32400128 http://dx.doi.org/10.4168/aair.2020.12.4.608 |
_version_ | 1783534016203325440 |
---|---|
author | Chen, Shuyu Deng, Yao He, Qiaoling Chen, Yanbo Wang, De Sun, Weimin He, Ying Zou, Zehong Liang, Zhenyu Chen, Rongchang Yao, Lihong Tao, Ailin |
author_facet | Chen, Shuyu Deng, Yao He, Qiaoling Chen, Yanbo Wang, De Sun, Weimin He, Ying Zou, Zehong Liang, Zhenyu Chen, Rongchang Yao, Lihong Tao, Ailin |
author_sort | Chen, Shuyu |
collection | PubMed |
description | PURPOSE: Accumulating evidence has suggested that toll-like receptor 4 (TLR4) is critically involved in the pathogenesis of asthma. The aim of this study was to investigate the role of TLR4 in toluene diisocyanate (TDI)-induced allergic airway inflammation. METHODS: TLR4(−/−) and wild-type (WT) C57BL/10J mice were sensitized and challenged with TDI to generate a TDI-induced asthma model. B-cell lymphoma 2 (Bcl-2) inhibitors, ABT-199 (4 mg/kg) and ABT-737 (4 mg/kg), were intranasally given to TDI-exposed TLR4(−/−) mice after each challenge. RESULTS: TDI exposure led to increased airway hyperresponsiveness (AHR), granulocyte flux, bronchial epithelial shedding and extensive submucosal collagen deposition, which were unexpectedly aggravated by TLR4 deficiency. Following TDI challenge, TLR4(−/−) mice exhibited down-regulated interleukin-17A and increased colony-stimulating factor 3 in bronchoalveolar lavage fluid (BALF), while WT mice did not. In addition, TLR4 deficiency robustly suppressed the expression of NOD-like receptor family pyrin domain containing 3 and NLR family CARD domain containing 4, decreased caspase-1 activity in TDI-exposed mice, but had no effect on the level of high mobility group box 1 in BALF. Flow cytometry revealed that TDI hampered both neutrophil and eosinophil apoptosis, of which neutrophil apoptosis was further inhibited in TDI-exposed TLR4(−/−) mice, with marked up-regulation of Bcl-2. Moreover, inhibition of Bcl-2 with either ABT-199 or ABT-737 significantly alleviated neutrophil recruitment by promoting apoptosis. CONCLUSIONS: These data indicated that TLR4 deficiency promoted neutrophil infiltration by impairing its apoptosis via up-regulation of Bcl-2, thereby resulting in deteriorated AHR and airway inflammation, which suggests that TLR4 could be a negative regulator of TDI-induced neutrophilic inflammation. |
format | Online Article Text |
id | pubmed-7225000 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | The Korean Academy of Asthma, Allergy and Clinical Immunology; The Korean Academy of Pediatric Allergy and Respiratory Disease |
record_format | MEDLINE/PubMed |
spelling | pubmed-72250002020-07-01 Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model Chen, Shuyu Deng, Yao He, Qiaoling Chen, Yanbo Wang, De Sun, Weimin He, Ying Zou, Zehong Liang, Zhenyu Chen, Rongchang Yao, Lihong Tao, Ailin Allergy Asthma Immunol Res Original Article PURPOSE: Accumulating evidence has suggested that toll-like receptor 4 (TLR4) is critically involved in the pathogenesis of asthma. The aim of this study was to investigate the role of TLR4 in toluene diisocyanate (TDI)-induced allergic airway inflammation. METHODS: TLR4(−/−) and wild-type (WT) C57BL/10J mice were sensitized and challenged with TDI to generate a TDI-induced asthma model. B-cell lymphoma 2 (Bcl-2) inhibitors, ABT-199 (4 mg/kg) and ABT-737 (4 mg/kg), were intranasally given to TDI-exposed TLR4(−/−) mice after each challenge. RESULTS: TDI exposure led to increased airway hyperresponsiveness (AHR), granulocyte flux, bronchial epithelial shedding and extensive submucosal collagen deposition, which were unexpectedly aggravated by TLR4 deficiency. Following TDI challenge, TLR4(−/−) mice exhibited down-regulated interleukin-17A and increased colony-stimulating factor 3 in bronchoalveolar lavage fluid (BALF), while WT mice did not. In addition, TLR4 deficiency robustly suppressed the expression of NOD-like receptor family pyrin domain containing 3 and NLR family CARD domain containing 4, decreased caspase-1 activity in TDI-exposed mice, but had no effect on the level of high mobility group box 1 in BALF. Flow cytometry revealed that TDI hampered both neutrophil and eosinophil apoptosis, of which neutrophil apoptosis was further inhibited in TDI-exposed TLR4(−/−) mice, with marked up-regulation of Bcl-2. Moreover, inhibition of Bcl-2 with either ABT-199 or ABT-737 significantly alleviated neutrophil recruitment by promoting apoptosis. CONCLUSIONS: These data indicated that TLR4 deficiency promoted neutrophil infiltration by impairing its apoptosis via up-regulation of Bcl-2, thereby resulting in deteriorated AHR and airway inflammation, which suggests that TLR4 could be a negative regulator of TDI-induced neutrophilic inflammation. The Korean Academy of Asthma, Allergy and Clinical Immunology; The Korean Academy of Pediatric Allergy and Respiratory Disease 2020-02-20 /pmc/articles/PMC7225000/ /pubmed/32400128 http://dx.doi.org/10.4168/aair.2020.12.4.608 Text en Copyright © 2020 The Korean Academy of Asthma, Allergy and Clinical Immunology • The Korean Academy of Pediatric Allergy and Respiratory Disease https://creativecommons.org/licenses/by-nc/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (https://creativecommons.org/licenses/by-nc/4.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Chen, Shuyu Deng, Yao He, Qiaoling Chen, Yanbo Wang, De Sun, Weimin He, Ying Zou, Zehong Liang, Zhenyu Chen, Rongchang Yao, Lihong Tao, Ailin Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title | Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title_full | Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title_fullStr | Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title_full_unstemmed | Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title_short | Toll-like Receptor 4 Deficiency Aggravates Airway Hyperresponsiveness and Inflammation by Impairing Neutrophil Apoptosis in a Toluene Diisocyanate-Induced Murine Asthma Model |
title_sort | toll-like receptor 4 deficiency aggravates airway hyperresponsiveness and inflammation by impairing neutrophil apoptosis in a toluene diisocyanate-induced murine asthma model |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7225000/ https://www.ncbi.nlm.nih.gov/pubmed/32400128 http://dx.doi.org/10.4168/aair.2020.12.4.608 |
work_keys_str_mv | AT chenshuyu tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT dengyao tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT heqiaoling tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT chenyanbo tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT wangde tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT sunweimin tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT heying tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT zouzehong tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT liangzhenyu tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT chenrongchang tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT yaolihong tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel AT taoailin tolllikereceptor4deficiencyaggravatesairwayhyperresponsivenessandinflammationbyimpairingneutrophilapoptosisinatoluenediisocyanateinducedmurineasthmamodel |