Cargando…
Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, whic...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7232391/ https://www.ncbi.nlm.nih.gov/pubmed/32260465 http://dx.doi.org/10.3390/microorganisms8040517 |
_version_ | 1783535376642605056 |
---|---|
author | Zhou, Peng Han, Xueqing Ye, Xiang Zheng, Feifei Yan, Ting Xie, Quan Zhang, Yong-An Curtiss, Roy Zhou, Yang |
author_facet | Zhou, Peng Han, Xueqing Ye, Xiang Zheng, Feifei Yan, Ting Xie, Quan Zhang, Yong-An Curtiss, Roy Zhou, Yang |
author_sort | Zhou, Peng |
collection | PubMed |
description | Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, which can regulate large quantities of operons in different bacteria. Here we characterize the crp gene and report the effect of a crp deletion in E. piscicida. The crp-deficient mutant lost the capacity to utilize maltose, and showed significantly reduced motility due to the lack of flagella synthesis. We further constructed a ΔP(crp) mutant to support that the phenotype above was caused by the crp deletion. Evidence obtained in fish serum killing assay and competitive infection assay strongly indicated that the inactivation of crp impaired the ability of E. piscicida to evade host immune clearance. More importantly, the virulence of the crp mutant was attenuated in both zebrafish and channel catfish, with reductions in mortality rates. In the end, we found that crp mutant could confer immune protection against E. piscicida infection to zebrafish and channel catfish, indicating its potential as a live attenuated vaccine. |
format | Online Article Text |
id | pubmed-7232391 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-72323912020-05-22 Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host Zhou, Peng Han, Xueqing Ye, Xiang Zheng, Feifei Yan, Ting Xie, Quan Zhang, Yong-An Curtiss, Roy Zhou, Yang Microorganisms Article Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, which can regulate large quantities of operons in different bacteria. Here we characterize the crp gene and report the effect of a crp deletion in E. piscicida. The crp-deficient mutant lost the capacity to utilize maltose, and showed significantly reduced motility due to the lack of flagella synthesis. We further constructed a ΔP(crp) mutant to support that the phenotype above was caused by the crp deletion. Evidence obtained in fish serum killing assay and competitive infection assay strongly indicated that the inactivation of crp impaired the ability of E. piscicida to evade host immune clearance. More importantly, the virulence of the crp mutant was attenuated in both zebrafish and channel catfish, with reductions in mortality rates. In the end, we found that crp mutant could confer immune protection against E. piscicida infection to zebrafish and channel catfish, indicating its potential as a live attenuated vaccine. MDPI 2020-04-04 /pmc/articles/PMC7232391/ /pubmed/32260465 http://dx.doi.org/10.3390/microorganisms8040517 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Zhou, Peng Han, Xueqing Ye, Xiang Zheng, Feifei Yan, Ting Xie, Quan Zhang, Yong-An Curtiss, Roy Zhou, Yang Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title | Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title_full | Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title_fullStr | Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title_full_unstemmed | Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title_short | Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host |
title_sort | phenotype, virulence and immunogenicity of edwardsiella piscicida cyclic amp receptor protein (crp) mutants in catfish host |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7232391/ https://www.ncbi.nlm.nih.gov/pubmed/32260465 http://dx.doi.org/10.3390/microorganisms8040517 |
work_keys_str_mv | AT zhoupeng phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT hanxueqing phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT yexiang phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT zhengfeifei phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT yanting phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT xiequan phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT zhangyongan phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT curtissroy phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost AT zhouyang phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost |