Cargando…

Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host

Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, whic...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Peng, Han, Xueqing, Ye, Xiang, Zheng, Feifei, Yan, Ting, Xie, Quan, Zhang, Yong-An, Curtiss, Roy, Zhou, Yang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7232391/
https://www.ncbi.nlm.nih.gov/pubmed/32260465
http://dx.doi.org/10.3390/microorganisms8040517
_version_ 1783535376642605056
author Zhou, Peng
Han, Xueqing
Ye, Xiang
Zheng, Feifei
Yan, Ting
Xie, Quan
Zhang, Yong-An
Curtiss, Roy
Zhou, Yang
author_facet Zhou, Peng
Han, Xueqing
Ye, Xiang
Zheng, Feifei
Yan, Ting
Xie, Quan
Zhang, Yong-An
Curtiss, Roy
Zhou, Yang
author_sort Zhou, Peng
collection PubMed
description Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, which can regulate large quantities of operons in different bacteria. Here we characterize the crp gene and report the effect of a crp deletion in E. piscicida. The crp-deficient mutant lost the capacity to utilize maltose, and showed significantly reduced motility due to the lack of flagella synthesis. We further constructed a ΔP(crp) mutant to support that the phenotype above was caused by the crp deletion. Evidence obtained in fish serum killing assay and competitive infection assay strongly indicated that the inactivation of crp impaired the ability of E. piscicida to evade host immune clearance. More importantly, the virulence of the crp mutant was attenuated in both zebrafish and channel catfish, with reductions in mortality rates. In the end, we found that crp mutant could confer immune protection against E. piscicida infection to zebrafish and channel catfish, indicating its potential as a live attenuated vaccine.
format Online
Article
Text
id pubmed-7232391
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-72323912020-05-22 Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host Zhou, Peng Han, Xueqing Ye, Xiang Zheng, Feifei Yan, Ting Xie, Quan Zhang, Yong-An Curtiss, Roy Zhou, Yang Microorganisms Article Edwardsiella piscicida, a facultative aerobic pathogen belonging to the Enterobacteriaceae family, is the etiological agent of edwardsiellosis that causes significant economic loses in the aquaculture industry. cAMP receptor protein (CRP) is one of the most important transcriptional regulators, which can regulate large quantities of operons in different bacteria. Here we characterize the crp gene and report the effect of a crp deletion in E. piscicida. The crp-deficient mutant lost the capacity to utilize maltose, and showed significantly reduced motility due to the lack of flagella synthesis. We further constructed a ΔP(crp) mutant to support that the phenotype above was caused by the crp deletion. Evidence obtained in fish serum killing assay and competitive infection assay strongly indicated that the inactivation of crp impaired the ability of E. piscicida to evade host immune clearance. More importantly, the virulence of the crp mutant was attenuated in both zebrafish and channel catfish, with reductions in mortality rates. In the end, we found that crp mutant could confer immune protection against E. piscicida infection to zebrafish and channel catfish, indicating its potential as a live attenuated vaccine. MDPI 2020-04-04 /pmc/articles/PMC7232391/ /pubmed/32260465 http://dx.doi.org/10.3390/microorganisms8040517 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Zhou, Peng
Han, Xueqing
Ye, Xiang
Zheng, Feifei
Yan, Ting
Xie, Quan
Zhang, Yong-An
Curtiss, Roy
Zhou, Yang
Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title_full Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title_fullStr Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title_full_unstemmed Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title_short Phenotype, Virulence and Immunogenicity of Edwardsiella piscicida Cyclic AMP Receptor Protein (Crp) Mutants in Catfish Host
title_sort phenotype, virulence and immunogenicity of edwardsiella piscicida cyclic amp receptor protein (crp) mutants in catfish host
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7232391/
https://www.ncbi.nlm.nih.gov/pubmed/32260465
http://dx.doi.org/10.3390/microorganisms8040517
work_keys_str_mv AT zhoupeng phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT hanxueqing phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT yexiang phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT zhengfeifei phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT yanting phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT xiequan phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT zhangyongan phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT curtissroy phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost
AT zhouyang phenotypevirulenceandimmunogenicityofedwardsiellapiscicidacyclicampreceptorproteincrpmutantsincatfishhost