Cargando…
Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7238198/ https://www.ncbi.nlm.nih.gov/pubmed/32283631 http://dx.doi.org/10.3390/plants9040475 |
_version_ | 1783536489982853120 |
---|---|
author | Nosek, Michał Kaczmarczyk, Adriana Jędrzejczyk, Roman J. Supel, Paulina Kaszycki, Paweł Miszalski, Zbigniew |
author_facet | Nosek, Michał Kaczmarczyk, Adriana Jędrzejczyk, Roman J. Supel, Paulina Kaszycki, Paweł Miszalski, Zbigniew |
author_sort | Nosek, Michał |
collection | PubMed |
description | Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (irt2–iron-regulated protein 2, zip4–zinc-induced protein 4), vacuolar sequestration (abcc2–ATP-binding cassette 2, cax4–cation exchanger 2 pcs1–phytochelatin synthase 1) and translocation into aerial organs (hma4–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte Mesembryanthemum crystallinum. The upregulation of irt2 expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for zip4. Stressor-induced alterations in abcc2, cax4, hma4 and pcs1 expression were most pronounced in the root tissue, and the expression of cax4, hma4 and pcs1 was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for irt2, was observed only in the case of pcs1. The importance of salt stress in the irt2 expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking. |
format | Online Article Text |
id | pubmed-7238198 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-72381982020-05-28 Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations Nosek, Michał Kaczmarczyk, Adriana Jędrzejczyk, Roman J. Supel, Paulina Kaszycki, Paweł Miszalski, Zbigniew Plants (Basel) Article Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (irt2–iron-regulated protein 2, zip4–zinc-induced protein 4), vacuolar sequestration (abcc2–ATP-binding cassette 2, cax4–cation exchanger 2 pcs1–phytochelatin synthase 1) and translocation into aerial organs (hma4–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte Mesembryanthemum crystallinum. The upregulation of irt2 expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for zip4. Stressor-induced alterations in abcc2, cax4, hma4 and pcs1 expression were most pronounced in the root tissue, and the expression of cax4, hma4 and pcs1 was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for irt2, was observed only in the case of pcs1. The importance of salt stress in the irt2 expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking. MDPI 2020-04-09 /pmc/articles/PMC7238198/ /pubmed/32283631 http://dx.doi.org/10.3390/plants9040475 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Nosek, Michał Kaczmarczyk, Adriana Jędrzejczyk, Roman J. Supel, Paulina Kaszycki, Paweł Miszalski, Zbigniew Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title_full | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title_fullStr | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title_full_unstemmed | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title_short | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
title_sort | expression of genes involved in heavy metal trafficking in plants exposed to salinity stress and elevated cd concentrations |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7238198/ https://www.ncbi.nlm.nih.gov/pubmed/32283631 http://dx.doi.org/10.3390/plants9040475 |
work_keys_str_mv | AT nosekmichał expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT kaczmarczykadriana expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT jedrzejczykromanj expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT supelpaulina expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT kaszyckipaweł expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT miszalskizbigniew expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations |