Cargando…

Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations

Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and...

Descripción completa

Detalles Bibliográficos
Autores principales: Nosek, Michał, Kaczmarczyk, Adriana, Jędrzejczyk, Roman J., Supel, Paulina, Kaszycki, Paweł, Miszalski, Zbigniew
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7238198/
https://www.ncbi.nlm.nih.gov/pubmed/32283631
http://dx.doi.org/10.3390/plants9040475
_version_ 1783536489982853120
author Nosek, Michał
Kaczmarczyk, Adriana
Jędrzejczyk, Roman J.
Supel, Paulina
Kaszycki, Paweł
Miszalski, Zbigniew
author_facet Nosek, Michał
Kaczmarczyk, Adriana
Jędrzejczyk, Roman J.
Supel, Paulina
Kaszycki, Paweł
Miszalski, Zbigniew
author_sort Nosek, Michał
collection PubMed
description Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (irt2–iron-regulated protein 2, zip4–zinc-induced protein 4), vacuolar sequestration (abcc2–ATP-binding cassette 2, cax4–cation exchanger 2 pcs1–phytochelatin synthase 1) and translocation into aerial organs (hma4–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte Mesembryanthemum crystallinum. The upregulation of irt2 expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for zip4. Stressor-induced alterations in abcc2, cax4, hma4 and pcs1 expression were most pronounced in the root tissue, and the expression of cax4, hma4 and pcs1 was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for irt2, was observed only in the case of pcs1. The importance of salt stress in the irt2 expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking.
format Online
Article
Text
id pubmed-7238198
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-72381982020-05-28 Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations Nosek, Michał Kaczmarczyk, Adriana Jędrzejczyk, Roman J. Supel, Paulina Kaszycki, Paweł Miszalski, Zbigniew Plants (Basel) Article Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (irt2–iron-regulated protein 2, zip4–zinc-induced protein 4), vacuolar sequestration (abcc2–ATP-binding cassette 2, cax4–cation exchanger 2 pcs1–phytochelatin synthase 1) and translocation into aerial organs (hma4–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte Mesembryanthemum crystallinum. The upregulation of irt2 expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for zip4. Stressor-induced alterations in abcc2, cax4, hma4 and pcs1 expression were most pronounced in the root tissue, and the expression of cax4, hma4 and pcs1 was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for irt2, was observed only in the case of pcs1. The importance of salt stress in the irt2 expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking. MDPI 2020-04-09 /pmc/articles/PMC7238198/ /pubmed/32283631 http://dx.doi.org/10.3390/plants9040475 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Nosek, Michał
Kaczmarczyk, Adriana
Jędrzejczyk, Roman J.
Supel, Paulina
Kaszycki, Paweł
Miszalski, Zbigniew
Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title_full Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title_fullStr Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title_full_unstemmed Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title_short Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
title_sort expression of genes involved in heavy metal trafficking in plants exposed to salinity stress and elevated cd concentrations
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7238198/
https://www.ncbi.nlm.nih.gov/pubmed/32283631
http://dx.doi.org/10.3390/plants9040475
work_keys_str_mv AT nosekmichał expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations
AT kaczmarczykadriana expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations
AT jedrzejczykromanj expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations
AT supelpaulina expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations
AT kaszyckipaweł expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations
AT miszalskizbigniew expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations