Cargando…
A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers
OBJECTIVE: Fimasartan, an angiotensin II type 1 receptor blocker, and linagliptin, a dipeptidyl-peptidase-4 inhibitor, are frequently coadministered to treat patients with hypertension and diabetes, respectively. This study sought to evaluate the pharmacokinetic interactions between fimasartan and l...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Dove
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7266304/ https://www.ncbi.nlm.nih.gov/pubmed/32546973 http://dx.doi.org/10.2147/DDDT.S248205 |
_version_ | 1783541281311424512 |
---|---|
author | Kang, Woo Youl Lee, Hae Won Gwon, Mi-Ri Cho, Seungil Shim, Wang-Seob Lee, Kyung-Tae Yang, Dong Heon Seong, Sook Jin Yoon, Young-Ran |
author_facet | Kang, Woo Youl Lee, Hae Won Gwon, Mi-Ri Cho, Seungil Shim, Wang-Seob Lee, Kyung-Tae Yang, Dong Heon Seong, Sook Jin Yoon, Young-Ran |
author_sort | Kang, Woo Youl |
collection | PubMed |
description | OBJECTIVE: Fimasartan, an angiotensin II type 1 receptor blocker, and linagliptin, a dipeptidyl-peptidase-4 inhibitor, are frequently coadministered to treat patients with hypertension and diabetes, respectively. This study sought to evaluate the pharmacokinetic interactions between fimasartan and linagliptin after co-administration in healthy Korean subjects. METHODS: The overall study was divided into two separate parts, with each part designed as an open-label, multiple-dose, two-period, and single-sequence study. In Part A, to investigate the effect of linagliptin on fimasartan, 25 subjects received 120 mg fimasartan alone once daily for seven days during Period I, and 120 mg fimasartan with 20 mg linagliptin for seven days during Period II. In Part B, to examine the effect of fimasartan on linagliptin, 12 subjects received only linagliptin once daily for seven days during Period I, followed by concomitant administration of fimasartan for seven days during Period II, at the same doses used in Part A. Serial blood samples were collected at scheduled intervals for up to 24 h after the last dose to determine the steady-state pharmacokinetics of both drugs. RESULTS: Thirty-six subjects completed the study. The geometric mean ratio and 90% confidence intervals for maximum plasma concentration at steady state (C(max,ss)) and area under the concentration–time curve at steady state (AUC(τ,ss)) of fimasartan with or without linagliptin were 1.2633 (0.9175–1.7396) and 1.1740 (1.0499–1.3126), respectively. The corresponding values for C(max,ss) and AUC(τ,ss) of linagliptin with or without fimasartan were 0.9804 (0.8480–1.1336) and 0.9950 (0.9322–1.0619), respectively. A total of eight adverse events (AEs) were reported and the incidence of AEs did not increase significantly with co-administration of the drugs. CONCLUSION: Our results suggest that there are no clinically significant pharmacokinetic interactions between fimasartan and linagliptin when co-administered. Treatments were well tolerated during the study, with no serious adverse effects. CLINICAL TRIAL REGISTRY: http://clinicaltrials.gov, NCT03250052. |
format | Online Article Text |
id | pubmed-7266304 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Dove |
record_format | MEDLINE/PubMed |
spelling | pubmed-72663042020-06-15 A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers Kang, Woo Youl Lee, Hae Won Gwon, Mi-Ri Cho, Seungil Shim, Wang-Seob Lee, Kyung-Tae Yang, Dong Heon Seong, Sook Jin Yoon, Young-Ran Drug Des Devel Ther Original Research OBJECTIVE: Fimasartan, an angiotensin II type 1 receptor blocker, and linagliptin, a dipeptidyl-peptidase-4 inhibitor, are frequently coadministered to treat patients with hypertension and diabetes, respectively. This study sought to evaluate the pharmacokinetic interactions between fimasartan and linagliptin after co-administration in healthy Korean subjects. METHODS: The overall study was divided into two separate parts, with each part designed as an open-label, multiple-dose, two-period, and single-sequence study. In Part A, to investigate the effect of linagliptin on fimasartan, 25 subjects received 120 mg fimasartan alone once daily for seven days during Period I, and 120 mg fimasartan with 20 mg linagliptin for seven days during Period II. In Part B, to examine the effect of fimasartan on linagliptin, 12 subjects received only linagliptin once daily for seven days during Period I, followed by concomitant administration of fimasartan for seven days during Period II, at the same doses used in Part A. Serial blood samples were collected at scheduled intervals for up to 24 h after the last dose to determine the steady-state pharmacokinetics of both drugs. RESULTS: Thirty-six subjects completed the study. The geometric mean ratio and 90% confidence intervals for maximum plasma concentration at steady state (C(max,ss)) and area under the concentration–time curve at steady state (AUC(τ,ss)) of fimasartan with or without linagliptin were 1.2633 (0.9175–1.7396) and 1.1740 (1.0499–1.3126), respectively. The corresponding values for C(max,ss) and AUC(τ,ss) of linagliptin with or without fimasartan were 0.9804 (0.8480–1.1336) and 0.9950 (0.9322–1.0619), respectively. A total of eight adverse events (AEs) were reported and the incidence of AEs did not increase significantly with co-administration of the drugs. CONCLUSION: Our results suggest that there are no clinically significant pharmacokinetic interactions between fimasartan and linagliptin when co-administered. Treatments were well tolerated during the study, with no serious adverse effects. CLINICAL TRIAL REGISTRY: http://clinicaltrials.gov, NCT03250052. Dove 2020-05-26 /pmc/articles/PMC7266304/ /pubmed/32546973 http://dx.doi.org/10.2147/DDDT.S248205 Text en © 2020 Kang et al. http://creativecommons.org/licenses/by-nc/3.0/ This work is published and licensed by Dove Medical Press Limited. The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed. For permission for commercial use of this work, please see paragraphs 4.2 and 5 of our Terms (https://www.dovepress.com/terms.php). |
spellingShingle | Original Research Kang, Woo Youl Lee, Hae Won Gwon, Mi-Ri Cho, Seungil Shim, Wang-Seob Lee, Kyung-Tae Yang, Dong Heon Seong, Sook Jin Yoon, Young-Ran A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title | A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title_full | A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title_fullStr | A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title_full_unstemmed | A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title_short | A Pharmacokinetic Drug Interaction Between Fimasartan and Linagliptin in Healthy Volunteers |
title_sort | pharmacokinetic drug interaction between fimasartan and linagliptin in healthy volunteers |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7266304/ https://www.ncbi.nlm.nih.gov/pubmed/32546973 http://dx.doi.org/10.2147/DDDT.S248205 |
work_keys_str_mv | AT kangwooyoul apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT leehaewon apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT gwonmiri apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT choseungil apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT shimwangseob apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT leekyungtae apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT yangdongheon apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT seongsookjin apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT yoonyoungran apharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT kangwooyoul pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT leehaewon pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT gwonmiri pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT choseungil pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT shimwangseob pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT leekyungtae pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT yangdongheon pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT seongsookjin pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers AT yoonyoungran pharmacokineticdruginteractionbetweenfimasartanandlinagliptininhealthyvolunteers |