Cargando…
Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts
BACKGROUND: In eco-epidemiological studies, Leishmania detection in vectors and reservoirs is frequently accomplished by high-throughput and sensitive molecular methods that target minicircle kinetoplast DNA (kDNA). A pan-Leishmania SYBR green quantitative PCR (qPCR) assay which detects the conserve...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268266/ https://www.ncbi.nlm.nih.gov/pubmed/32487217 http://dx.doi.org/10.1186/s13071-020-04141-y |
_version_ | 1783541579378589696 |
---|---|
author | Pareyn, Myrthe Hendrickx, Rik Girma, Nigatu Hendrickx, Sarah Van Bockstal, Lieselotte Van Houtte, Natalie Shibru, Simon Maes, Louis Leirs, Herwig Caljon, Guy |
author_facet | Pareyn, Myrthe Hendrickx, Rik Girma, Nigatu Hendrickx, Sarah Van Bockstal, Lieselotte Van Houtte, Natalie Shibru, Simon Maes, Louis Leirs, Herwig Caljon, Guy |
author_sort | Pareyn, Myrthe |
collection | PubMed |
description | BACKGROUND: In eco-epidemiological studies, Leishmania detection in vectors and reservoirs is frequently accomplished by high-throughput and sensitive molecular methods that target minicircle kinetoplast DNA (kDNA). A pan-Leishmania SYBR green quantitative PCR (qPCR) assay which detects the conserved spliced-leader RNA (SL RNA) sequence was developed recently. This study assessed the SL RNA assay performance combined with a crude extraction method for the detection of Leishmania in field-collected and laboratory-reared sand flies and in tissue samples from hyraxes as reservoir hosts. METHODS: Field-collected and laboratory-infected sand fly and hyrax extracts were subjected to three different qPCR approaches to assess the suitability of the SL RNA target for Leishmania detection. Nucleic acids of experimentally infected sand flies were isolated with a crude extraction buffer with ethanol precipitation and a commercial kit and tested for downstream DNA and RNA detection. Promastigotes were isolated from culture and sand fly midguts to assess whether there was difference in SL RNA and kDNA copy numbers. Naive sand flies were spiked with a serial dilution of promastigotes to make a standard curve. RESULTS: The qPCR targeting SL RNA performed well on infected sand fly samples, despite preservation and extraction under presumed unfavorable conditions for downstream RNA detection. Nucleic acid extraction by a crude extraction buffer combined with a precipitation step was highly compatible with downstream SL RNA and kDNA detection. Copy numbers of kDNA were found to be identical in culture-derived parasites and promastigotes isolated from sand fly midguts. SL RNA levels were slightly lower in sand fly promastigotes (ΔCq 1.7). The theoretical limit of detection and quantification of the SL RNA qPCR respectively reached down to 10(−3) and 10 parasite equivalents. SL RNA detection in stored hyrax samples was less efficient with some false-negative assay results, most likely due to the long-term tissue storage in absence of RNA stabilizing reagents. CONCLUSIONS: This study shows that a crude extraction method in combination with the SL RNA qPCR assay is suitable for the detection and quantification of Leishmania in sand flies. The assay is inexpensive, sensitive and pan-Leishmania specific, and accordingly an excellent assay for high-throughput screening in entomological research. [Image: see text] |
format | Online Article Text |
id | pubmed-7268266 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-72682662020-06-07 Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts Pareyn, Myrthe Hendrickx, Rik Girma, Nigatu Hendrickx, Sarah Van Bockstal, Lieselotte Van Houtte, Natalie Shibru, Simon Maes, Louis Leirs, Herwig Caljon, Guy Parasit Vectors Research BACKGROUND: In eco-epidemiological studies, Leishmania detection in vectors and reservoirs is frequently accomplished by high-throughput and sensitive molecular methods that target minicircle kinetoplast DNA (kDNA). A pan-Leishmania SYBR green quantitative PCR (qPCR) assay which detects the conserved spliced-leader RNA (SL RNA) sequence was developed recently. This study assessed the SL RNA assay performance combined with a crude extraction method for the detection of Leishmania in field-collected and laboratory-reared sand flies and in tissue samples from hyraxes as reservoir hosts. METHODS: Field-collected and laboratory-infected sand fly and hyrax extracts were subjected to three different qPCR approaches to assess the suitability of the SL RNA target for Leishmania detection. Nucleic acids of experimentally infected sand flies were isolated with a crude extraction buffer with ethanol precipitation and a commercial kit and tested for downstream DNA and RNA detection. Promastigotes were isolated from culture and sand fly midguts to assess whether there was difference in SL RNA and kDNA copy numbers. Naive sand flies were spiked with a serial dilution of promastigotes to make a standard curve. RESULTS: The qPCR targeting SL RNA performed well on infected sand fly samples, despite preservation and extraction under presumed unfavorable conditions for downstream RNA detection. Nucleic acid extraction by a crude extraction buffer combined with a precipitation step was highly compatible with downstream SL RNA and kDNA detection. Copy numbers of kDNA were found to be identical in culture-derived parasites and promastigotes isolated from sand fly midguts. SL RNA levels were slightly lower in sand fly promastigotes (ΔCq 1.7). The theoretical limit of detection and quantification of the SL RNA qPCR respectively reached down to 10(−3) and 10 parasite equivalents. SL RNA detection in stored hyrax samples was less efficient with some false-negative assay results, most likely due to the long-term tissue storage in absence of RNA stabilizing reagents. CONCLUSIONS: This study shows that a crude extraction method in combination with the SL RNA qPCR assay is suitable for the detection and quantification of Leishmania in sand flies. The assay is inexpensive, sensitive and pan-Leishmania specific, and accordingly an excellent assay for high-throughput screening in entomological research. [Image: see text] BioMed Central 2020-06-01 /pmc/articles/PMC7268266/ /pubmed/32487217 http://dx.doi.org/10.1186/s13071-020-04141-y Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Pareyn, Myrthe Hendrickx, Rik Girma, Nigatu Hendrickx, Sarah Van Bockstal, Lieselotte Van Houtte, Natalie Shibru, Simon Maes, Louis Leirs, Herwig Caljon, Guy Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title | Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title_full | Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title_fullStr | Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title_full_unstemmed | Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title_short | Evaluation of a pan-Leishmania SL RNA qPCR assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
title_sort | evaluation of a pan-leishmania sl rna qpcr assay for parasite detection in laboratory-reared and field-collected sand flies and reservoir hosts |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268266/ https://www.ncbi.nlm.nih.gov/pubmed/32487217 http://dx.doi.org/10.1186/s13071-020-04141-y |
work_keys_str_mv | AT pareynmyrthe evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT hendrickxrik evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT girmanigatu evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT hendrickxsarah evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT vanbockstallieselotte evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT vanhouttenatalie evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT shibrusimon evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT maeslouis evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT leirsherwig evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts AT caljonguy evaluationofapanleishmaniaslrnaqpcrassayforparasitedetectioninlaboratoryrearedandfieldcollectedsandfliesandreservoirhosts |