Cargando…
A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta
Amelogenesis is the process of enamel formation. For amelogenesis to proceed, the cells of the inner enamel epithelium (IEE) must first proliferate and then differentiate into the enamel-producing ameloblasts. Amelogenesis imperfecta (AI) is a heterogeneous group of genetic conditions that result in...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268548/ https://www.ncbi.nlm.nih.gov/pubmed/32167558 http://dx.doi.org/10.1093/hmg/ddaa041 |
_version_ | 1783541641169076224 |
---|---|
author | Smith, Claire E L Whitehouse, Laura L E Poulter, James A Wilkinson Hewitt, Laura Nadat, Fatima Jackson, Brian R Manfield, Iain W Edwards, Thomas A Rodd, Helen D Inglehearn, Chris F Mighell, Alan J |
author_facet | Smith, Claire E L Whitehouse, Laura L E Poulter, James A Wilkinson Hewitt, Laura Nadat, Fatima Jackson, Brian R Manfield, Iain W Edwards, Thomas A Rodd, Helen D Inglehearn, Chris F Mighell, Alan J |
author_sort | Smith, Claire E L |
collection | PubMed |
description | Amelogenesis is the process of enamel formation. For amelogenesis to proceed, the cells of the inner enamel epithelium (IEE) must first proliferate and then differentiate into the enamel-producing ameloblasts. Amelogenesis imperfecta (AI) is a heterogeneous group of genetic conditions that result in defective or absent tooth enamel. We identified a 2 bp variant c.817_818GC>AA in SP6, the gene encoding the SP6 transcription factor, in a Caucasian family with autosomal dominant hypoplastic AI. The resulting missense protein change, p.(Ala273Lys), is predicted to alter a DNA-binding residue in the first of three zinc fingers. SP6 has been shown to be crucial to both proliferation of the IEE and to its differentiation into ameloblasts. SP6 has also been implicated as an AI candidate gene through its study in rodent models. We investigated the effect of the missense variant in SP6 (p.(Ala273Lys)) using surface plasmon resonance protein-DNA binding studies. We identified a potential SP6 binding motif in the AMBN proximal promoter sequence and showed that wild-type (WT) SP6 binds more strongly to it than the mutant protein. We hypothesize that SP6 variants may be a very rare cause of AI due to the critical roles of SP6 in development and that the relatively mild effect of the missense variant identified in this study is sufficient to affect amelogenesis causing AI, but not so severe as to be incompatible with life. We suggest that current AI cohorts, both with autosomal recessive and dominant disease, be screened for SP6 variants. |
format | Online Article Text |
id | pubmed-7268548 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-72685482020-06-09 A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta Smith, Claire E L Whitehouse, Laura L E Poulter, James A Wilkinson Hewitt, Laura Nadat, Fatima Jackson, Brian R Manfield, Iain W Edwards, Thomas A Rodd, Helen D Inglehearn, Chris F Mighell, Alan J Hum Mol Genet General Article Amelogenesis is the process of enamel formation. For amelogenesis to proceed, the cells of the inner enamel epithelium (IEE) must first proliferate and then differentiate into the enamel-producing ameloblasts. Amelogenesis imperfecta (AI) is a heterogeneous group of genetic conditions that result in defective or absent tooth enamel. We identified a 2 bp variant c.817_818GC>AA in SP6, the gene encoding the SP6 transcription factor, in a Caucasian family with autosomal dominant hypoplastic AI. The resulting missense protein change, p.(Ala273Lys), is predicted to alter a DNA-binding residue in the first of three zinc fingers. SP6 has been shown to be crucial to both proliferation of the IEE and to its differentiation into ameloblasts. SP6 has also been implicated as an AI candidate gene through its study in rodent models. We investigated the effect of the missense variant in SP6 (p.(Ala273Lys)) using surface plasmon resonance protein-DNA binding studies. We identified a potential SP6 binding motif in the AMBN proximal promoter sequence and showed that wild-type (WT) SP6 binds more strongly to it than the mutant protein. We hypothesize that SP6 variants may be a very rare cause of AI due to the critical roles of SP6 in development and that the relatively mild effect of the missense variant identified in this study is sufficient to affect amelogenesis causing AI, but not so severe as to be incompatible with life. We suggest that current AI cohorts, both with autosomal recessive and dominant disease, be screened for SP6 variants. Oxford University Press 2020-06-03 2020-03-13 /pmc/articles/PMC7268548/ /pubmed/32167558 http://dx.doi.org/10.1093/hmg/ddaa041 Text en © The Author(s) 2020. Published by Oxford University Press. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | General Article Smith, Claire E L Whitehouse, Laura L E Poulter, James A Wilkinson Hewitt, Laura Nadat, Fatima Jackson, Brian R Manfield, Iain W Edwards, Thomas A Rodd, Helen D Inglehearn, Chris F Mighell, Alan J A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title | A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title_full | A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title_fullStr | A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title_full_unstemmed | A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title_short | A missense variant in specificity protein 6 (SP6) is associated with amelogenesis imperfecta |
title_sort | missense variant in specificity protein 6 (sp6) is associated with amelogenesis imperfecta |
topic | General Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268548/ https://www.ncbi.nlm.nih.gov/pubmed/32167558 http://dx.doi.org/10.1093/hmg/ddaa041 |
work_keys_str_mv | AT smithclaireel amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT whitehouselaurale amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT poulterjamesa amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT wilkinsonhewittlaura amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT nadatfatima amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT jacksonbrianr amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT manfieldiainw amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT edwardsthomasa amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT roddhelend amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT inglehearnchrisf amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT mighellalanj amissensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT smithclaireel missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT whitehouselaurale missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT poulterjamesa missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT wilkinsonhewittlaura missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT nadatfatima missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT jacksonbrianr missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT manfieldiainw missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT edwardsthomasa missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT roddhelend missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT inglehearnchrisf missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta AT mighellalanj missensevariantinspecificityprotein6sp6isassociatedwithamelogenesisimperfecta |