Cargando…
Local expression profiles of vitamin D-related genes in airways of COPD patients
Treatment of Chronic Obstructive Pulmonary Disease (COPD) is based on bronchodilation, with inhaled corticosteroids or azithromycin associated when frequent exacerbations occur. Despite the proven benefits of current treatment regimens, the need for new interventions in delineated subgroups remains....
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268690/ https://www.ncbi.nlm.nih.gov/pubmed/32493333 http://dx.doi.org/10.1186/s12931-020-01405-0 |
_version_ | 1783541672375746560 |
---|---|
author | Mathyssen, Carolien Aelbrecht, Celine Serré, Jef Everaerts, Stephanie Maes, Karen Gayan-Ramirez, Ghislaine Vanaudenaerde, Bart Janssens, Wim |
author_facet | Mathyssen, Carolien Aelbrecht, Celine Serré, Jef Everaerts, Stephanie Maes, Karen Gayan-Ramirez, Ghislaine Vanaudenaerde, Bart Janssens, Wim |
author_sort | Mathyssen, Carolien |
collection | PubMed |
description | Treatment of Chronic Obstructive Pulmonary Disease (COPD) is based on bronchodilation, with inhaled corticosteroids or azithromycin associated when frequent exacerbations occur. Despite the proven benefits of current treatment regimens, the need for new interventions in delineated subgroups remains. There is convincing evidence for oral vitamin D supplementation in reducing exacerbations in COPD patients severely deficient for circulating vitamin D. However, little is known about local vitamin D metabolism in the airways and studies examining expression of the vitamin D receptor (VDR), the activating enzyme (CYP27B1) and inactivating enzyme (CYP24A1) of vitamin D in lung tissue of COPD patients are lacking. Therefore, the expression and localization of key enzymes and the receptor of the vitamin D pathway were examined in tissue of 10 unused donor lungs and 10 COPD explant lungs. No differences in the expression of CYP27B1 and CYP24A1 were found. Although protein expression of VDR was significantly lower in COPD explant tissue, there was no difference in downstream expression of the antimicrobial peptide cathelicidin. Whereas CYP27B1 and CYP24A1 were present in all layers of the bronchial epithelium, VDR was only expressed at the apical layer of a fully differentiated bronchial epithelium with no expression in vascular endothelial cells. By contrast, CYP24A1 expression was highly present in lung endothelial cells suggesting that systemic vitamin D can be inactivated before reaching the epithelial compartment and the tissue immune cells. These data support the idea of exploring the role of vitamin D inhalation in patients with COPD. |
format | Online Article Text |
id | pubmed-7268690 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-72686902020-06-08 Local expression profiles of vitamin D-related genes in airways of COPD patients Mathyssen, Carolien Aelbrecht, Celine Serré, Jef Everaerts, Stephanie Maes, Karen Gayan-Ramirez, Ghislaine Vanaudenaerde, Bart Janssens, Wim Respir Res Research Treatment of Chronic Obstructive Pulmonary Disease (COPD) is based on bronchodilation, with inhaled corticosteroids or azithromycin associated when frequent exacerbations occur. Despite the proven benefits of current treatment regimens, the need for new interventions in delineated subgroups remains. There is convincing evidence for oral vitamin D supplementation in reducing exacerbations in COPD patients severely deficient for circulating vitamin D. However, little is known about local vitamin D metabolism in the airways and studies examining expression of the vitamin D receptor (VDR), the activating enzyme (CYP27B1) and inactivating enzyme (CYP24A1) of vitamin D in lung tissue of COPD patients are lacking. Therefore, the expression and localization of key enzymes and the receptor of the vitamin D pathway were examined in tissue of 10 unused donor lungs and 10 COPD explant lungs. No differences in the expression of CYP27B1 and CYP24A1 were found. Although protein expression of VDR was significantly lower in COPD explant tissue, there was no difference in downstream expression of the antimicrobial peptide cathelicidin. Whereas CYP27B1 and CYP24A1 were present in all layers of the bronchial epithelium, VDR was only expressed at the apical layer of a fully differentiated bronchial epithelium with no expression in vascular endothelial cells. By contrast, CYP24A1 expression was highly present in lung endothelial cells suggesting that systemic vitamin D can be inactivated before reaching the epithelial compartment and the tissue immune cells. These data support the idea of exploring the role of vitamin D inhalation in patients with COPD. BioMed Central 2020-06-03 2020 /pmc/articles/PMC7268690/ /pubmed/32493333 http://dx.doi.org/10.1186/s12931-020-01405-0 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Mathyssen, Carolien Aelbrecht, Celine Serré, Jef Everaerts, Stephanie Maes, Karen Gayan-Ramirez, Ghislaine Vanaudenaerde, Bart Janssens, Wim Local expression profiles of vitamin D-related genes in airways of COPD patients |
title | Local expression profiles of vitamin D-related genes in airways of COPD patients |
title_full | Local expression profiles of vitamin D-related genes in airways of COPD patients |
title_fullStr | Local expression profiles of vitamin D-related genes in airways of COPD patients |
title_full_unstemmed | Local expression profiles of vitamin D-related genes in airways of COPD patients |
title_short | Local expression profiles of vitamin D-related genes in airways of COPD patients |
title_sort | local expression profiles of vitamin d-related genes in airways of copd patients |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7268690/ https://www.ncbi.nlm.nih.gov/pubmed/32493333 http://dx.doi.org/10.1186/s12931-020-01405-0 |
work_keys_str_mv | AT mathyssencarolien localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT aelbrechtceline localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT serrejef localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT everaertsstephanie localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT maeskaren localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT gayanramirezghislaine localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT vanaudenaerdebart localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients AT janssenswim localexpressionprofilesofvitamindrelatedgenesinairwaysofcopdpatients |