Cargando…

Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia

Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different ge...

Descripción completa

Detalles Bibliográficos
Autores principales: Rabiei, Mohammad, Cahyono, Mohamad Indro, Doan, Phuong Thi Kim, Pandarangga, Putri, Tarigan, Simson, Indriani, Risa, Dharmayanti, Indi, Ignjatovic, Jagoda, Low, Wai Yee, Tearle, Rick, McAllister, Milton M., Alsharifi, Mohammed, Hemmatzadeh, Farhid
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7272544/
https://www.ncbi.nlm.nih.gov/pubmed/32499363
http://dx.doi.org/10.1128/MRA.00204-20
_version_ 1783542274430337024
author Rabiei, Mohammad
Cahyono, Mohamad Indro
Doan, Phuong Thi Kim
Pandarangga, Putri
Tarigan, Simson
Indriani, Risa
Dharmayanti, Indi
Ignjatovic, Jagoda
Low, Wai Yee
Tearle, Rick
McAllister, Milton M.
Alsharifi, Mohammed
Hemmatzadeh, Farhid
author_facet Rabiei, Mohammad
Cahyono, Mohamad Indro
Doan, Phuong Thi Kim
Pandarangga, Putri
Tarigan, Simson
Indriani, Risa
Dharmayanti, Indi
Ignjatovic, Jagoda
Low, Wai Yee
Tearle, Rick
McAllister, Milton M.
Alsharifi, Mohammed
Hemmatzadeh, Farhid
author_sort Rabiei, Mohammad
collection PubMed
description Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different genotypes of NDV revealed that these two strains belong to genotype VII.2 in the class II cluster of avian paramyxoviruses.
format Online
Article
Text
id pubmed-7272544
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-72725442020-06-09 Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia Rabiei, Mohammad Cahyono, Mohamad Indro Doan, Phuong Thi Kim Pandarangga, Putri Tarigan, Simson Indriani, Risa Dharmayanti, Indi Ignjatovic, Jagoda Low, Wai Yee Tearle, Rick McAllister, Milton M. Alsharifi, Mohammed Hemmatzadeh, Farhid Microbiol Resour Announc Genome Sequences Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different genotypes of NDV revealed that these two strains belong to genotype VII.2 in the class II cluster of avian paramyxoviruses. American Society for Microbiology 2020-06-04 /pmc/articles/PMC7272544/ /pubmed/32499363 http://dx.doi.org/10.1128/MRA.00204-20 Text en Copyright © 2020 Rabiei et al. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Genome Sequences
Rabiei, Mohammad
Cahyono, Mohamad Indro
Doan, Phuong Thi Kim
Pandarangga, Putri
Tarigan, Simson
Indriani, Risa
Dharmayanti, Indi
Ignjatovic, Jagoda
Low, Wai Yee
Tearle, Rick
McAllister, Milton M.
Alsharifi, Mohammed
Hemmatzadeh, Farhid
Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title_full Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title_fullStr Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title_full_unstemmed Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title_short Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
title_sort genome sequences of newly emerged newcastle disease virus strains isolated from disease outbreaks in indonesia
topic Genome Sequences
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7272544/
https://www.ncbi.nlm.nih.gov/pubmed/32499363
http://dx.doi.org/10.1128/MRA.00204-20
work_keys_str_mv AT rabieimohammad genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT cahyonomohamadindro genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT doanphuongthikim genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT pandaranggaputri genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT tarigansimson genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT indrianirisa genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT dharmayantiindi genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT ignjatovicjagoda genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT lowwaiyee genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT tearlerick genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT mcallistermiltonm genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT alsharifimohammed genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia
AT hemmatzadehfarhid genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia