Cargando…
Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia
Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different ge...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society for Microbiology
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7272544/ https://www.ncbi.nlm.nih.gov/pubmed/32499363 http://dx.doi.org/10.1128/MRA.00204-20 |
_version_ | 1783542274430337024 |
---|---|
author | Rabiei, Mohammad Cahyono, Mohamad Indro Doan, Phuong Thi Kim Pandarangga, Putri Tarigan, Simson Indriani, Risa Dharmayanti, Indi Ignjatovic, Jagoda Low, Wai Yee Tearle, Rick McAllister, Milton M. Alsharifi, Mohammed Hemmatzadeh, Farhid |
author_facet | Rabiei, Mohammad Cahyono, Mohamad Indro Doan, Phuong Thi Kim Pandarangga, Putri Tarigan, Simson Indriani, Risa Dharmayanti, Indi Ignjatovic, Jagoda Low, Wai Yee Tearle, Rick McAllister, Milton M. Alsharifi, Mohammed Hemmatzadeh, Farhid |
author_sort | Rabiei, Mohammad |
collection | PubMed |
description | Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different genotypes of NDV revealed that these two strains belong to genotype VII.2 in the class II cluster of avian paramyxoviruses. |
format | Online Article Text |
id | pubmed-7272544 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | American Society for Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-72725442020-06-09 Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia Rabiei, Mohammad Cahyono, Mohamad Indro Doan, Phuong Thi Kim Pandarangga, Putri Tarigan, Simson Indriani, Risa Dharmayanti, Indi Ignjatovic, Jagoda Low, Wai Yee Tearle, Rick McAllister, Milton M. Alsharifi, Mohammed Hemmatzadeh, Farhid Microbiol Resour Announc Genome Sequences Here, we report two genomes of newly emerged strains of Newcastle disease virus (NDV), Chicken/Indonesia/Tangerang/004WJ/14 and Chicken/Indonesia/VD/003WJ/11, from disease outbreaks in chickens in Indonesia. Phylogenetic study results of the fusion (F) protein’s gene-coding sequences of different genotypes of NDV revealed that these two strains belong to genotype VII.2 in the class II cluster of avian paramyxoviruses. American Society for Microbiology 2020-06-04 /pmc/articles/PMC7272544/ /pubmed/32499363 http://dx.doi.org/10.1128/MRA.00204-20 Text en Copyright © 2020 Rabiei et al. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Genome Sequences Rabiei, Mohammad Cahyono, Mohamad Indro Doan, Phuong Thi Kim Pandarangga, Putri Tarigan, Simson Indriani, Risa Dharmayanti, Indi Ignjatovic, Jagoda Low, Wai Yee Tearle, Rick McAllister, Milton M. Alsharifi, Mohammed Hemmatzadeh, Farhid Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title | Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title_full | Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title_fullStr | Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title_full_unstemmed | Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title_short | Genome Sequences of Newly Emerged Newcastle Disease Virus Strains Isolated from Disease Outbreaks in Indonesia |
title_sort | genome sequences of newly emerged newcastle disease virus strains isolated from disease outbreaks in indonesia |
topic | Genome Sequences |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7272544/ https://www.ncbi.nlm.nih.gov/pubmed/32499363 http://dx.doi.org/10.1128/MRA.00204-20 |
work_keys_str_mv | AT rabieimohammad genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT cahyonomohamadindro genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT doanphuongthikim genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT pandaranggaputri genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT tarigansimson genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT indrianirisa genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT dharmayantiindi genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT ignjatovicjagoda genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT lowwaiyee genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT tearlerick genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT mcallistermiltonm genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT alsharifimohammed genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia AT hemmatzadehfarhid genomesequencesofnewlyemergednewcastlediseasevirusstrainsisolatedfromdiseaseoutbreaksinindonesia |