Cargando…
Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017
BACKGROUND: Measles is a highly infectious viral disease. In August 2017, Lyantonde District, Uganda reported a measles outbreak to Uganda Ministry of Health. We investigated the outbreak to assess the scope, factors facilitating transmission, and recommend control measures. METHODS: We defined a pr...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7274507/ https://www.ncbi.nlm.nih.gov/pubmed/32503450 http://dx.doi.org/10.1186/s12879-020-05120-5 |
_version_ | 1783542598213828608 |
---|---|
author | Biribawa, Claire Atuhairwe, Joselyn Annet Bulage, Lilian Okethwangu, Denis Othuba Kwesiga, Benon Ario, Alex Riolexus Zhu, Bao-Ping |
author_facet | Biribawa, Claire Atuhairwe, Joselyn Annet Bulage, Lilian Okethwangu, Denis Othuba Kwesiga, Benon Ario, Alex Riolexus Zhu, Bao-Ping |
author_sort | Biribawa, Claire |
collection | PubMed |
description | BACKGROUND: Measles is a highly infectious viral disease. In August 2017, Lyantonde District, Uganda reported a measles outbreak to Uganda Ministry of Health. We investigated the outbreak to assess the scope, factors facilitating transmission, and recommend control measures. METHODS: We defined a probable case as sudden onset of fever and generalized rash in a resident of Lyantonde, Lwengo, or Rakai Districts from 1 June-30 September 2017, plus ≥1 of the following: coryza, conjunctivitis, or cough. A confirmed case was a probable case with serum positivity of measles-specific IgM. We conducted a neighborhood- and age-matched case-control study to identified exposure factors, and used conditional logistic regression to analyze the data. We estimated vaccine effectiveness and vaccination coverage. RESULTS: We identified 81 cases (75 probable, 6 confirmed); 4 patients (4.9%) died. In the case-control study, 47% of case-patients and 2.3% of controls were hospitalized at Lyantonde Hospital pediatric department for non-measles conditions 7–21 days before case-patient’s onset (OR(adj) = 34, 95%CI: 5.1–225). Estimated vaccine effectiveness was 95% (95%CI: 75–99%) and vaccination coverage was 76% (95%CI: 68–82%). During the outbreak, an “isolation” ward was established inside the general pediatric ward where there was mixing of both measles and non-measles patients. CONCLUSIONS: This outbreak was amplified by nosocomial transmission and facilitated by low vaccination coverage. We recommended moving the isolation ward outside of the building, supplemental vaccination, and vaccinating pediatric patients during measles outbreaks. |
format | Online Article Text |
id | pubmed-7274507 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-72745072020-06-08 Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 Biribawa, Claire Atuhairwe, Joselyn Annet Bulage, Lilian Okethwangu, Denis Othuba Kwesiga, Benon Ario, Alex Riolexus Zhu, Bao-Ping BMC Infect Dis Research Article BACKGROUND: Measles is a highly infectious viral disease. In August 2017, Lyantonde District, Uganda reported a measles outbreak to Uganda Ministry of Health. We investigated the outbreak to assess the scope, factors facilitating transmission, and recommend control measures. METHODS: We defined a probable case as sudden onset of fever and generalized rash in a resident of Lyantonde, Lwengo, or Rakai Districts from 1 June-30 September 2017, plus ≥1 of the following: coryza, conjunctivitis, or cough. A confirmed case was a probable case with serum positivity of measles-specific IgM. We conducted a neighborhood- and age-matched case-control study to identified exposure factors, and used conditional logistic regression to analyze the data. We estimated vaccine effectiveness and vaccination coverage. RESULTS: We identified 81 cases (75 probable, 6 confirmed); 4 patients (4.9%) died. In the case-control study, 47% of case-patients and 2.3% of controls were hospitalized at Lyantonde Hospital pediatric department for non-measles conditions 7–21 days before case-patient’s onset (OR(adj) = 34, 95%CI: 5.1–225). Estimated vaccine effectiveness was 95% (95%CI: 75–99%) and vaccination coverage was 76% (95%CI: 68–82%). During the outbreak, an “isolation” ward was established inside the general pediatric ward where there was mixing of both measles and non-measles patients. CONCLUSIONS: This outbreak was amplified by nosocomial transmission and facilitated by low vaccination coverage. We recommended moving the isolation ward outside of the building, supplemental vaccination, and vaccinating pediatric patients during measles outbreaks. BioMed Central 2020-06-05 /pmc/articles/PMC7274507/ /pubmed/32503450 http://dx.doi.org/10.1186/s12879-020-05120-5 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Biribawa, Claire Atuhairwe, Joselyn Annet Bulage, Lilian Okethwangu, Denis Othuba Kwesiga, Benon Ario, Alex Riolexus Zhu, Bao-Ping Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title | Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title_full | Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title_fullStr | Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title_full_unstemmed | Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title_short | Measles outbreak amplified in a pediatric ward: Lyantonde District, Uganda, August 2017 |
title_sort | measles outbreak amplified in a pediatric ward: lyantonde district, uganda, august 2017 |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7274507/ https://www.ncbi.nlm.nih.gov/pubmed/32503450 http://dx.doi.org/10.1186/s12879-020-05120-5 |
work_keys_str_mv | AT biribawaclaire measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT atuhairwejoselynannet measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT bulagelilian measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT okethwangudenisothuba measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT kwesigabenon measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT arioalexriolexus measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 AT zhubaoping measlesoutbreakamplifiedinapediatricwardlyantondedistrictugandaaugust2017 |