Cargando…
Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines
BACKGROUND: Sepsis guidelines are widely used in high-income countries and intravenous fluids are an important supportive treatment modality. However, fluids have been harmful in intervention trials in low-income countries, most notably in sub-Saharan Africa. We assessed the relevance, quality and a...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7275525/ https://www.ncbi.nlm.nih.gov/pubmed/32503647 http://dx.doi.org/10.1186/s13054-020-02978-4 |
_version_ | 1783542803321585664 |
---|---|
author | Silberberg, Benjamin Aston, Stephen Boztepe, Selda Jacob, Shevin Rylance, Jamie |
author_facet | Silberberg, Benjamin Aston, Stephen Boztepe, Selda Jacob, Shevin Rylance, Jamie |
author_sort | Silberberg, Benjamin |
collection | PubMed |
description | BACKGROUND: Sepsis guidelines are widely used in high-income countries and intravenous fluids are an important supportive treatment modality. However, fluids have been harmful in intervention trials in low-income countries, most notably in sub-Saharan Africa. We assessed the relevance, quality and applicability of available guidelines for the fluid management of adult patients with sepsis in this region. METHODS: We identified sepsis guidelines by systematic review with broad search terms, duplicate screening and data extraction. We included peer-reviewed publications with explicit relevance to sepsis and fluid therapy. We excluded those designed exclusively for specific aetiologies of sepsis, for limited geographic locations, or for non-adult populations. We used the AGREE II tool to assess the quality of guideline development, performed a narrative synthesis and used theoretical case scenarios to assess practical applicability to everyday clinical practice in resource-constrained settings. RESULTS: Published sepsis guidelines are heterogeneous in sepsis definition and in quality: 8/10 guidelines had significant deficits in applicability, particularly with reference to resource considerations in low-income settings. Indications for intravenous fluid were hypotension (8/10), clinical markers of hypoperfusion (6/10) and lactataemia (3/10). Crystalloids were overwhelmingly recommended (9/10). Suggested volumes varied; 5/10 explicitly recommended “fluid challenges” with reassessment, totalling between 1 L and 4 L during initial resuscitation. Fluid balance, including later de-escalation of therapy, was not specifically described in any. Norepinephrine was the preferred initial vasopressor (5/10), specifically targeted to MAP > 65 mmHg (3/10), with higher values suggested in pre-existing hypertension (1/10). Recommendations for guidelines were almost universally derived from evidence in high-income countries. None of the guidelines suggested any refinement for patients with malnutrition. CONCLUSIONS: Widely used international guidelines contain disparate recommendations on intravenous fluid use, lack specificity and are largely unattainable in low-income countries given available resources. A relative lack of high-quality evidence from sub-Saharan Africa increases reliance on recommendations which may not be relevant or implementable. |
format | Online Article Text |
id | pubmed-7275525 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-72755252020-06-08 Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines Silberberg, Benjamin Aston, Stephen Boztepe, Selda Jacob, Shevin Rylance, Jamie Crit Care Research BACKGROUND: Sepsis guidelines are widely used in high-income countries and intravenous fluids are an important supportive treatment modality. However, fluids have been harmful in intervention trials in low-income countries, most notably in sub-Saharan Africa. We assessed the relevance, quality and applicability of available guidelines for the fluid management of adult patients with sepsis in this region. METHODS: We identified sepsis guidelines by systematic review with broad search terms, duplicate screening and data extraction. We included peer-reviewed publications with explicit relevance to sepsis and fluid therapy. We excluded those designed exclusively for specific aetiologies of sepsis, for limited geographic locations, or for non-adult populations. We used the AGREE II tool to assess the quality of guideline development, performed a narrative synthesis and used theoretical case scenarios to assess practical applicability to everyday clinical practice in resource-constrained settings. RESULTS: Published sepsis guidelines are heterogeneous in sepsis definition and in quality: 8/10 guidelines had significant deficits in applicability, particularly with reference to resource considerations in low-income settings. Indications for intravenous fluid were hypotension (8/10), clinical markers of hypoperfusion (6/10) and lactataemia (3/10). Crystalloids were overwhelmingly recommended (9/10). Suggested volumes varied; 5/10 explicitly recommended “fluid challenges” with reassessment, totalling between 1 L and 4 L during initial resuscitation. Fluid balance, including later de-escalation of therapy, was not specifically described in any. Norepinephrine was the preferred initial vasopressor (5/10), specifically targeted to MAP > 65 mmHg (3/10), with higher values suggested in pre-existing hypertension (1/10). Recommendations for guidelines were almost universally derived from evidence in high-income countries. None of the guidelines suggested any refinement for patients with malnutrition. CONCLUSIONS: Widely used international guidelines contain disparate recommendations on intravenous fluid use, lack specificity and are largely unattainable in low-income countries given available resources. A relative lack of high-quality evidence from sub-Saharan Africa increases reliance on recommendations which may not be relevant or implementable. BioMed Central 2020-06-05 /pmc/articles/PMC7275525/ /pubmed/32503647 http://dx.doi.org/10.1186/s13054-020-02978-4 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Silberberg, Benjamin Aston, Stephen Boztepe, Selda Jacob, Shevin Rylance, Jamie Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title | Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title_full | Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title_fullStr | Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title_full_unstemmed | Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title_short | Recommendations for fluid management of adults with sepsis in sub-Saharan Africa: a systematic review of guidelines |
title_sort | recommendations for fluid management of adults with sepsis in sub-saharan africa: a systematic review of guidelines |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7275525/ https://www.ncbi.nlm.nih.gov/pubmed/32503647 http://dx.doi.org/10.1186/s13054-020-02978-4 |
work_keys_str_mv | AT silberbergbenjamin recommendationsforfluidmanagementofadultswithsepsisinsubsaharanafricaasystematicreviewofguidelines AT astonstephen recommendationsforfluidmanagementofadultswithsepsisinsubsaharanafricaasystematicreviewofguidelines AT boztepeselda recommendationsforfluidmanagementofadultswithsepsisinsubsaharanafricaasystematicreviewofguidelines AT jacobshevin recommendationsforfluidmanagementofadultswithsepsisinsubsaharanafricaasystematicreviewofguidelines AT rylancejamie recommendationsforfluidmanagementofadultswithsepsisinsubsaharanafricaasystematicreviewofguidelines |