Cargando…
HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression
BACKGROUND: The advent of immune checkpoint blockade antibodies has demonstrated that effective mobilization of T cell responses can cause tumor regression of metastatic cancers, although these responses are heterogeneous and restricted to certain histologic types of cancer. To enhance these respons...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BMJ Publishing Group
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7295440/ https://www.ncbi.nlm.nih.gov/pubmed/32532838 http://dx.doi.org/10.1136/jitc-2019-000258 |
_version_ | 1783546645904883712 |
---|---|
author | Chen, Alan Chen Xu, Renhuan Wang, Tao Wei, Junping Yang, Xiao-Yi Liu, Cong-Xiao Lei, Gangjun Lyerly, Herbert Kim Heiland, Teri Hartman, Zachary Conrad |
author_facet | Chen, Alan Chen Xu, Renhuan Wang, Tao Wei, Junping Yang, Xiao-Yi Liu, Cong-Xiao Lei, Gangjun Lyerly, Herbert Kim Heiland, Teri Hartman, Zachary Conrad |
author_sort | Chen, Alan Chen |
collection | PubMed |
description | BACKGROUND: The advent of immune checkpoint blockade antibodies has demonstrated that effective mobilization of T cell responses can cause tumor regression of metastatic cancers, although these responses are heterogeneous and restricted to certain histologic types of cancer. To enhance these responses, there has been renewed emphasis in developing effective cancer-specific vaccines to stimulate and direct T cell immunity to important oncologic targets, such as the oncogene human epidermal growth factor receptor 2 (HER2), expressed in ~20% of breast cancers (BCs). METHODS: In our study, we explored the use of alternative antigen trafficking through use of a lysosome-associated membrane protein 1 (LAMP) domain to enhance vaccine efficacy against HER2 and other model antigens in both in vitro and in vivo studies. RESULTS: We found that inclusion of this domain in plasmid vaccines effectively trafficked antigens to endolysosomal compartments, resulting in enhanced major histocompatibility complex (MHC) class I and II presentation. Additionally, this augmented the expansion/activation of antigen-specific CD4+ and CD8+ T cells and also led to elevated levels of antigen-specific polyfunctional CD8+ T cells. Significantly, vaccination with HER2-LAMP produced tumor regression in ~30% of vaccinated mice with established tumors in an endogenous model of metastatic HER2+ BC, compared with 0% of HER2-WT vaccinated mice. This therapeutic benefit is associated with enhanced tumor infiltration of activated CD4+ and CD8+ T cells. CONCLUSIONS: These data demonstrate the potential of using LAMP-based endolysosomal trafficking as a means to augment the generation of polyfunctional, antigen-specific T cells in order to improve antitumor therapeutic responses using cancer antigen vaccines. |
format | Online Article Text |
id | pubmed-7295440 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BMJ Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-72954402020-06-19 HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression Chen, Alan Chen Xu, Renhuan Wang, Tao Wei, Junping Yang, Xiao-Yi Liu, Cong-Xiao Lei, Gangjun Lyerly, Herbert Kim Heiland, Teri Hartman, Zachary Conrad J Immunother Cancer Immune Cell Therapies and Immune Cell Engineering BACKGROUND: The advent of immune checkpoint blockade antibodies has demonstrated that effective mobilization of T cell responses can cause tumor regression of metastatic cancers, although these responses are heterogeneous and restricted to certain histologic types of cancer. To enhance these responses, there has been renewed emphasis in developing effective cancer-specific vaccines to stimulate and direct T cell immunity to important oncologic targets, such as the oncogene human epidermal growth factor receptor 2 (HER2), expressed in ~20% of breast cancers (BCs). METHODS: In our study, we explored the use of alternative antigen trafficking through use of a lysosome-associated membrane protein 1 (LAMP) domain to enhance vaccine efficacy against HER2 and other model antigens in both in vitro and in vivo studies. RESULTS: We found that inclusion of this domain in plasmid vaccines effectively trafficked antigens to endolysosomal compartments, resulting in enhanced major histocompatibility complex (MHC) class I and II presentation. Additionally, this augmented the expansion/activation of antigen-specific CD4+ and CD8+ T cells and also led to elevated levels of antigen-specific polyfunctional CD8+ T cells. Significantly, vaccination with HER2-LAMP produced tumor regression in ~30% of vaccinated mice with established tumors in an endogenous model of metastatic HER2+ BC, compared with 0% of HER2-WT vaccinated mice. This therapeutic benefit is associated with enhanced tumor infiltration of activated CD4+ and CD8+ T cells. CONCLUSIONS: These data demonstrate the potential of using LAMP-based endolysosomal trafficking as a means to augment the generation of polyfunctional, antigen-specific T cells in order to improve antitumor therapeutic responses using cancer antigen vaccines. BMJ Publishing Group 2020-06-12 /pmc/articles/PMC7295440/ /pubmed/32532838 http://dx.doi.org/10.1136/jitc-2019-000258 Text en © Author(s) (or their employer(s)) 2020. Re-use permitted under CC BY-NC. No commercial re-use. See rights and permissions. Published by BMJ. http://creativecommons.org/licenses/by-nc/4.0/This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, appropriate credit is given, any changes made indicated, and the use is non-commercial. See http://creativecommons.org/licenses/by-nc/4.0/. |
spellingShingle | Immune Cell Therapies and Immune Cell Engineering Chen, Alan Chen Xu, Renhuan Wang, Tao Wei, Junping Yang, Xiao-Yi Liu, Cong-Xiao Lei, Gangjun Lyerly, Herbert Kim Heiland, Teri Hartman, Zachary Conrad HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title | HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title_full | HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title_fullStr | HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title_full_unstemmed | HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title_short | HER2-LAMP vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional T cell responses that induce complete tumor regression |
title_sort | her2-lamp vaccines effectively traffic to endolysosomal compartments and generate enhanced polyfunctional t cell responses that induce complete tumor regression |
topic | Immune Cell Therapies and Immune Cell Engineering |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7295440/ https://www.ncbi.nlm.nih.gov/pubmed/32532838 http://dx.doi.org/10.1136/jitc-2019-000258 |
work_keys_str_mv | AT chenalanchen her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT xurenhuan her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT wangtao her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT weijunping her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT yangxiaoyi her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT liucongxiao her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT leigangjun her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT lyerlyherbertkim her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT heilandteri her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression AT hartmanzacharyconrad her2lampvaccineseffectivelytraffictoendolysosomalcompartmentsandgenerateenhancedpolyfunctionaltcellresponsesthatinducecompletetumorregression |