Cargando…

High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte

BACKGROUND: Understanding the genetics underlying the heritable subphenotypes of sickle cell anemia, specific to each population, would be prognostically useful and could inform personalized therapeutics.The objective of this study was to describe the genetic modulators of sickle cell disease in a c...

Descripción completa

Detalles Bibliográficos
Autores principales: Chamouine, Abdourahim, Saandi, Thoueiba, Muszlak, Mathias, Larmaraud, Juliette, Lambrecht, Laurent, Poisson, Jean, Balicchi, Julien, Pissard, Serge, Elenga, Narcisse
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7305627/
https://www.ncbi.nlm.nih.gov/pubmed/32563256
http://dx.doi.org/10.1186/s12887-020-02187-6
_version_ 1783548503554785280
author Chamouine, Abdourahim
Saandi, Thoueiba
Muszlak, Mathias
Larmaraud, Juliette
Lambrecht, Laurent
Poisson, Jean
Balicchi, Julien
Pissard, Serge
Elenga, Narcisse
author_facet Chamouine, Abdourahim
Saandi, Thoueiba
Muszlak, Mathias
Larmaraud, Juliette
Lambrecht, Laurent
Poisson, Jean
Balicchi, Julien
Pissard, Serge
Elenga, Narcisse
author_sort Chamouine, Abdourahim
collection PubMed
description BACKGROUND: Understanding the genetics underlying the heritable subphenotypes of sickle cell anemia, specific to each population, would be prognostically useful and could inform personalized therapeutics.The objective of this study was to describe the genetic modulators of sickle cell disease in a cohort of pediatric patients followed up in Mayotte. METHODS: This retrospective cohort study analyzed clinical and biological data, collected between January1(st)2007 and December 31(st)2017, in children younger than 18 years. RESULTS: We included 185 children with 72% SS, 16% Sβ0-thalassemia and 12% Sβ + thalassemia. The average age was 9.5 years; 10% of patients were lost to follow up. The Bantu haplotype was associated with an increase in hospitalizations and transfusions. The alpha-thalassemic mutation was associated with a decrease of hemolysis biological parameters (anemia, reticulocytes), and a decrease of cerebral vasculopathy. The Single Nucleotide Polymorphisms BCL11A rs4671393, BCL11A rs11886868, BCL11A rs1427407 and HMIP rs9399137 were associated with the group of children with HbF > 10%. Patients with HbF > 10% presented a significant risk of early onset of cerebral vasculopathy. CONCLUSIONS: The most remarkable result of our study was the association of SNPs with clinically relevant phenotypic groups. BCL11A rs4671393, BCL11A rs11886868, BCL11A rs1427407 and HMIP rs9399137 were correlated with HbF > 10%, a group that has a higher risk of cerebral vasculopathy and should be oriented towards the hemolytic sub-phenotype.
format Online
Article
Text
id pubmed-7305627
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-73056272020-06-22 High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte Chamouine, Abdourahim Saandi, Thoueiba Muszlak, Mathias Larmaraud, Juliette Lambrecht, Laurent Poisson, Jean Balicchi, Julien Pissard, Serge Elenga, Narcisse BMC Pediatr Research Article BACKGROUND: Understanding the genetics underlying the heritable subphenotypes of sickle cell anemia, specific to each population, would be prognostically useful and could inform personalized therapeutics.The objective of this study was to describe the genetic modulators of sickle cell disease in a cohort of pediatric patients followed up in Mayotte. METHODS: This retrospective cohort study analyzed clinical and biological data, collected between January1(st)2007 and December 31(st)2017, in children younger than 18 years. RESULTS: We included 185 children with 72% SS, 16% Sβ0-thalassemia and 12% Sβ + thalassemia. The average age was 9.5 years; 10% of patients were lost to follow up. The Bantu haplotype was associated with an increase in hospitalizations and transfusions. The alpha-thalassemic mutation was associated with a decrease of hemolysis biological parameters (anemia, reticulocytes), and a decrease of cerebral vasculopathy. The Single Nucleotide Polymorphisms BCL11A rs4671393, BCL11A rs11886868, BCL11A rs1427407 and HMIP rs9399137 were associated with the group of children with HbF > 10%. Patients with HbF > 10% presented a significant risk of early onset of cerebral vasculopathy. CONCLUSIONS: The most remarkable result of our study was the association of SNPs with clinically relevant phenotypic groups. BCL11A rs4671393, BCL11A rs11886868, BCL11A rs1427407 and HMIP rs9399137 were correlated with HbF > 10%, a group that has a higher risk of cerebral vasculopathy and should be oriented towards the hemolytic sub-phenotype. BioMed Central 2020-06-20 /pmc/articles/PMC7305627/ /pubmed/32563256 http://dx.doi.org/10.1186/s12887-020-02187-6 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Chamouine, Abdourahim
Saandi, Thoueiba
Muszlak, Mathias
Larmaraud, Juliette
Lambrecht, Laurent
Poisson, Jean
Balicchi, Julien
Pissard, Serge
Elenga, Narcisse
High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title_full High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title_fullStr High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title_full_unstemmed High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title_short High fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in Mayotte
title_sort high fetal hemoglobin level is associated with increased risk of cerebral vasculopathy in children with sickle cell disease in mayotte
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7305627/
https://www.ncbi.nlm.nih.gov/pubmed/32563256
http://dx.doi.org/10.1186/s12887-020-02187-6
work_keys_str_mv AT chamouineabdourahim highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT saandithoueiba highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT muszlakmathias highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT larmaraudjuliette highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT lambrechtlaurent highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT poissonjean highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT balicchijulien highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT pissardserge highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte
AT elenganarcisse highfetalhemoglobinlevelisassociatedwithincreasedriskofcerebralvasculopathyinchildrenwithsicklecelldiseaseinmayotte