Cargando…
Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old u...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
S. Karger GmbH
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7316657/ https://www.ncbi.nlm.nih.gov/pubmed/32999889 http://dx.doi.org/10.1159/000508740 |
_version_ | 1783550466047606784 |
---|---|
author | Abdullah, Abdullah Neurath, Markus F. Atreya, Raja |
author_facet | Abdullah, Abdullah Neurath, Markus F. Atreya, Raja |
author_sort | Abdullah, Abdullah |
collection | PubMed |
description | The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old ulcerative colitis patient in sustained clinical remission who 4 days after application of her ongoing therapy with the anti-TNF antibody infliximab developed mild respiratory and abdominal symptoms. The patient was subsequently diagnosed with COVID-19 but did not need hospitalization. The clinical symptoms completely resolved within 1 week after onset and there was no change in ulcerative colitis activity. The recently applied anti-TNF therapy did not lead to exacerbation of the infectious symptoms. Current recommendations strongly favor continuation of effective maintenance anti-TNF therapy in inflammatory bowel disease patients, as there is no evidence for aggravated COVID-19 upon infection. It is unclear whether anti-TNF treatment might even have assisted in preventing worsening of COVID-19 and improving outcome. Further data in the group of immune-mediated inflammatory disease patients under anti-TNF therapy are urgently needed. |
format | Online Article Text |
id | pubmed-7316657 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | S. Karger GmbH |
record_format | MEDLINE/PubMed |
spelling | pubmed-73166572020-07-02 Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? Abdullah, Abdullah Neurath, Markus F. Atreya, Raja Visc Med Case Report The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old ulcerative colitis patient in sustained clinical remission who 4 days after application of her ongoing therapy with the anti-TNF antibody infliximab developed mild respiratory and abdominal symptoms. The patient was subsequently diagnosed with COVID-19 but did not need hospitalization. The clinical symptoms completely resolved within 1 week after onset and there was no change in ulcerative colitis activity. The recently applied anti-TNF therapy did not lead to exacerbation of the infectious symptoms. Current recommendations strongly favor continuation of effective maintenance anti-TNF therapy in inflammatory bowel disease patients, as there is no evidence for aggravated COVID-19 upon infection. It is unclear whether anti-TNF treatment might even have assisted in preventing worsening of COVID-19 and improving outcome. Further data in the group of immune-mediated inflammatory disease patients under anti-TNF therapy are urgently needed. S. Karger GmbH 2020-08 2020-06-05 /pmc/articles/PMC7316657/ /pubmed/32999889 http://dx.doi.org/10.1159/000508740 Text en Copyright © 2020 by S. Karger AG, Basel |
spellingShingle | Case Report Abdullah, Abdullah Neurath, Markus F. Atreya, Raja Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title | Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title_full | Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title_fullStr | Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title_full_unstemmed | Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title_short | Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? |
title_sort | mild covid-19 symptoms in an infliximab-treated ulcerative colitis patient: can ongoing anti-tnf therapy protect against the viral hyperinflammatory response and avoid aggravated outcomes? |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7316657/ https://www.ncbi.nlm.nih.gov/pubmed/32999889 http://dx.doi.org/10.1159/000508740 |
work_keys_str_mv | AT abdullahabdullah mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes AT neurathmarkusf mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes AT atreyaraja mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes |