Cargando…

Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?

The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old u...

Descripción completa

Detalles Bibliográficos
Autores principales: Abdullah, Abdullah, Neurath, Markus F., Atreya, Raja
Formato: Online Artículo Texto
Lenguaje:English
Publicado: S. Karger GmbH 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7316657/
https://www.ncbi.nlm.nih.gov/pubmed/32999889
http://dx.doi.org/10.1159/000508740
_version_ 1783550466047606784
author Abdullah, Abdullah
Neurath, Markus F.
Atreya, Raja
author_facet Abdullah, Abdullah
Neurath, Markus F.
Atreya, Raja
author_sort Abdullah, Abdullah
collection PubMed
description The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old ulcerative colitis patient in sustained clinical remission who 4 days after application of her ongoing therapy with the anti-TNF antibody infliximab developed mild respiratory and abdominal symptoms. The patient was subsequently diagnosed with COVID-19 but did not need hospitalization. The clinical symptoms completely resolved within 1 week after onset and there was no change in ulcerative colitis activity. The recently applied anti-TNF therapy did not lead to exacerbation of the infectious symptoms. Current recommendations strongly favor continuation of effective maintenance anti-TNF therapy in inflammatory bowel disease patients, as there is no evidence for aggravated CO­VID-19 upon infection. It is unclear whether anti-TNF treatment might even have assisted in preventing worsening of COVID-19 and improving outcome. Further data in the group of immune-mediated inflammatory disease patients under anti-TNF therapy are urgently needed.
format Online
Article
Text
id pubmed-7316657
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher S. Karger GmbH
record_format MEDLINE/PubMed
spelling pubmed-73166572020-07-02 Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes? Abdullah, Abdullah Neurath, Markus F. Atreya, Raja Visc Med Case Report The ongoing coronavirus disease 2019 (COVID-19) pandemic, caused by severe acute respiratory syndrome coronavirus 2, represents a potentially major challenge to patients with immune-mediated inflammatory diseases who are treated with immunomodulatory therapies. We report the case of an 18-year-old ulcerative colitis patient in sustained clinical remission who 4 days after application of her ongoing therapy with the anti-TNF antibody infliximab developed mild respiratory and abdominal symptoms. The patient was subsequently diagnosed with COVID-19 but did not need hospitalization. The clinical symptoms completely resolved within 1 week after onset and there was no change in ulcerative colitis activity. The recently applied anti-TNF therapy did not lead to exacerbation of the infectious symptoms. Current recommendations strongly favor continuation of effective maintenance anti-TNF therapy in inflammatory bowel disease patients, as there is no evidence for aggravated CO­VID-19 upon infection. It is unclear whether anti-TNF treatment might even have assisted in preventing worsening of COVID-19 and improving outcome. Further data in the group of immune-mediated inflammatory disease patients under anti-TNF therapy are urgently needed. S. Karger GmbH 2020-08 2020-06-05 /pmc/articles/PMC7316657/ /pubmed/32999889 http://dx.doi.org/10.1159/000508740 Text en Copyright © 2020 by S. Karger AG, Basel
spellingShingle Case Report
Abdullah, Abdullah
Neurath, Markus F.
Atreya, Raja
Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title_full Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title_fullStr Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title_full_unstemmed Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title_short Mild COVID-19 Symptoms in an Infliximab-Treated Ulcerative Colitis Patient: Can Ongoing Anti-TNF Therapy Protect against the Viral Hyperinflammatory Response and Avoid Aggravated Outcomes?
title_sort mild covid-19 symptoms in an infliximab-treated ulcerative colitis patient: can ongoing anti-tnf therapy protect against the viral hyperinflammatory response and avoid aggravated outcomes?
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7316657/
https://www.ncbi.nlm.nih.gov/pubmed/32999889
http://dx.doi.org/10.1159/000508740
work_keys_str_mv AT abdullahabdullah mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes
AT neurathmarkusf mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes
AT atreyaraja mildcovid19symptomsinaninfliximabtreatedulcerativecolitispatientcanongoingantitnftherapyprotectagainsttheviralhyperinflammatoryresponseandavoidaggravatedoutcomes